SecReT4
Protein ID: 238918310
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0347
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]346998..349862 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDC5BDH3
KEGG IDeic:NT01EI_0347
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.7e-59, Aligned region: 53..323
AAA_10 [PF12846], Evalue: 8.7e-45, Aligned region: 517..864
Protein Sequence: 954 a.a.     [Download]
>gi|238918310|ref|YP_002931824.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MFSLFGRKNEVKPDGTAGQPEGEVSPLVIHGREPLTRPGRMTRQEEAKVYHANPSIIDYLPWVEFLDEDQ
CLLLEDGISVGAVYDVKPVATEGRTNDRLEQIRDTVEDALQDSFDEYDENPWVVQFFCQDEDDAEAYLDH
LRGYVKPHAQRTAFTEAWLGEMARHIRSISRPEGLFTDALITGQLWRGQQRRTRMVIYRWSGKSASRDPM
PPVAMLNQACERVVSALGGAGIRCTRQNGLQVHSWLLRLFNPSPDWVDKSTLYRQAAYADPRDFPAGVAP
VSNDFAETLWFTPPVSDPENGVWWIDNKLHCALPVERLRTPPEPGTITGEQARGEKKINALMDMFPEGTL
LCMTIVVQPQDRLEEQFNRLSKNAVGENTESGRVRQDVKTVKEYLGNRHKLYRAGITFLLRGDDMDNLKR
KRLDLTTVLLGAGLQPVRSEFEVGPLNTWLRALPMCFNPNSDKKHWYTRLTWVQHLAGLLPVTGRETGTG
NPGFSFFNRGGDILTFDPLNKYDRTQNAHLLLFGPTGAGKSATLCYAFSQLMAVHRPRLFIAEAGNSFGL
QADYFESLGLSVNKISVKPGSGVSLPPFADAHKLVEEGLAAHAVDESDLPDIDADSDGEGEDEDKRDILG
EMEISARMMITGGDPKEEAEMKRADRAMIREALLMAAHATYKEGRQMLPSDLQKALYSIAGDDSDEGQNV
RNAQRKAKAAEMAEALGMFTQEGSFEAELFNREGELWPEADVTLVDLGHLAREGYEAQMALTMVSMTNMI
NNIAERDQYLGRDIVFAVDEAHIVTVNPLLSPYMTKVVKMWRKLGAWLWLATQNLKDFPDIAEKMLNMAE
WWICLTMPPEEVKDISRFRALTPEQEAVLLSARKLSGCYTEGVVLAKRIEALFRAVPPSLYLALGMTEKE
EKAERRALMREHHCSELDAAKLIARKLDRLRGLTDAHDEESTAA
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|238917983|ref|NC_012779.1|:346998-349862 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGTTTTCTCTTTTCGGCCGTAAAAATGAAGTGAAACCCGATGGCACGGCAGGGCAGCCAGAGGGGGAGG
TCTCTCCTCTGGTTATTCACGGCCGGGAGCCACTGACGCGACCAGGCCGGATGACCCGGCAGGAAGAGGC
AAAAGTGTATCACGCTAATCCGTCCATCATTGATTATCTGCCATGGGTGGAATTCCTGGATGAAGATCAG
TGTCTTCTGCTTGAGGACGGTATCTCCGTCGGTGCCGTTTATGACGTGAAGCCAGTAGCCACGGAAGGGC
GCACAAATGATCGTCTGGAGCAGATCCGCGATACGGTGGAAGATGCCCTGCAGGACAGCTTTGATGAATA
TGATGAGAATCCCTGGGTGGTGCAGTTCTTCTGCCAGGATGAAGATGATGCTGAAGCGTATCTGGACCAC
TTACGCGGCTACGTGAAACCGCATGCGCAGCGCACGGCATTTACGGAGGCTTGGCTGGGTGAAATGGCAC
GTCATATCCGCAGTATCTCGCGGCCGGAGGGGCTGTTTACCGATGCGTTGATCACCGGTCAGCTGTGGCG
CGGCCAGCAGCGTCGCACCCGTATGGTTATTTATCGCTGGAGCGGGAAGTCCGCTTCCCGGGACCCGATG
CCGCCGGTAGCGATGCTCAACCAGGCGTGTGAACGTGTGGTCAGTGCGCTGGGCGGGGCCGGTATTCGTT
GTACCCGTCAGAATGGCCTGCAGGTGCACAGCTGGCTGCTGCGCCTGTTTAATCCGTCTCCGGACTGGGT
GGATAAATCCACACTCTATCGTCAGGCGGCGTATGCCGATCCGCGCGACTTCCCGGCGGGCGTGGCACCA
GTCAGCAATGATTTTGCTGAAACGCTGTGGTTTACGCCACCCGTTTCGGATCCGGAGAACGGCGTATGGT
GGATAGATAATAAACTACATTGTGCTCTGCCGGTTGAGAGACTGCGTACCCCGCCGGAGCCAGGTACCAT
CACCGGTGAACAGGCCCGCGGTGAGAAAAAAATCAACGCACTGATGGATATGTTTCCAGAAGGGACACTG
CTGTGCATGACGATTGTTGTGCAGCCGCAGGACAGGCTGGAAGAACAGTTCAACCGCCTGTCGAAAAATG
CCGTCGGGGAGAATACCGAATCCGGCCGTGTCCGTCAGGATGTGAAAACGGTGAAAGAGTATCTGGGAAA
CCGGCATAAGCTGTATCGTGCCGGGATCACCTTCCTTCTGCGCGGTGATGATATGGATAATCTTAAGCGC
AAACGTCTTGATTTGACCACCGTATTGCTTGGGGCCGGCCTGCAGCCGGTTCGATCGGAATTTGAGGTGG
GGCCGCTGAATACCTGGCTGCGGGCGCTGCCAATGTGCTTTAACCCGAACAGCGATAAAAAACATTGGTA
CACCCGCCTGACCTGGGTACAGCACCTGGCAGGGTTGCTACCGGTTACCGGGCGGGAAACCGGTACCGGC
AACCCGGGTTTCAGCTTTTTTAACCGCGGCGGTGATATTCTGACGTTTGATCCACTGAACAAGTATGACC
GTACCCAGAATGCGCATCTGTTGTTGTTCGGACCGACGGGGGCAGGTAAATCAGCCACGCTGTGTTATGC
CTTTTCTCAACTGATGGCGGTTCACCGGCCACGTCTGTTTATCGCTGAAGCTGGGAACAGTTTTGGCCTG
CAGGCTGATTATTTTGAAAGCCTTGGACTTTCTGTCAACAAGATAAGCGTCAAACCGGGTAGTGGGGTCA
GCCTGCCGCCGTTTGCCGACGCGCATAAACTGGTCGAAGAAGGGCTGGCAGCACATGCCGTTGATGAGAG
CGATCTCCCCGATATCGATGCCGACAGTGACGGAGAGGGTGAAGACGAGGATAAGCGGGATATTCTCGGT
GAGATGGAGATTTCAGCCCGCATGATGATAACGGGCGGCGATCCGAAAGAAGAAGCCGAAATGAAGCGTG
CCGACCGGGCTATGATCCGTGAAGCGCTGCTGATGGCCGCGCATGCAACATATAAAGAAGGGAGGCAGAT
GCTGCCTTCTGACCTGCAGAAAGCGTTATACAGCATTGCCGGTGATGACAGCGATGAGGGGCAGAATGTC
CGTAATGCCCAGCGTAAGGCGAAAGCCGCAGAGATGGCGGAGGCGCTGGGGATGTTCACTCAGGAAGGCA
GCTTTGAGGCGGAGCTGTTCAACCGCGAGGGGGAATTGTGGCCTGAAGCGGATGTGACCCTGGTGGATCT
CGGTCATCTGGCGCGTGAGGGTTATGAAGCGCAGATGGCGCTGACCATGGTGTCAATGACCAACATGATT
AACAATATTGCAGAGCGGGATCAGTATCTCGGCCGCGATATAGTCTTCGCGGTGGATGAGGCGCATATTG
TGACGGTTAATCCACTGCTGTCGCCGTATATGACCAAAGTGGTCAAAATGTGGCGAAAGTTAGGGGCCTG
GCTGTGGCTGGCCACGCAGAACCTGAAGGACTTCCCGGATATTGCGGAGAAAATGCTGAACATGGCGGAG
TGGTGGATTTGCCTCACCATGCCACCGGAAGAGGTGAAAGACATCAGCCGGTTCCGTGCACTCACGCCTG
AACAGGAAGCCGTGCTGCTTTCCGCCCGTAAGCTGTCAGGTTGCTATACAGAAGGGGTGGTGCTGGCCAA
ACGTATTGAGGCGCTGTTCCGTGCTGTTCCCCCCAGTCTGTATCTTGCGCTGGGCATGACGGAGAAAGAG
GAAAAGGCGGAACGCCGGGCGCTGATGCGTGAGCATCACTGTAGCGAACTGGACGCGGCGAAGCTGATTG
CCCGTAAACTGGACCGGTTGCGCGGACTGACTGACGCACACGACGAGGAGAGCACTGCAGCATGA