SecReT4
Protein ID: 238918315
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0352
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]355280..355675 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDC5BDH8
KEGG IDeic:NT01EI_0352
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.3e-36, Aligned region: 19..125
Protein Sequence: 131 a.a.     [Download]
>gi|238918315|ref|YP_002931829.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MKLRDFILLPALLPVSVLAGTVVYTDSQHLPENLSPGVVAVLLDAPERLQAKMFGQLSTDPEQAAAQVRL
AMSSPQWQQKQQQLVAAYRQVVHAWELGIRKVPAVVFDDRDVVYGTTDVAQALRLQAGGDQ
 
Nucleotide Sequence: 396 bp     [Download]
>gi|238917983|ref|NC_012779.1|:355280-355675 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAAATTACGTGATTTTATCCTTCTGCCGGCATTGTTGCCGGTGTCCGTTCTGGCCGGCACGGTGGTCT
ATACCGACAGCCAGCACTTACCTGAAAATCTTTCTCCGGGTGTTGTAGCTGTGTTGCTGGATGCACCTGA
ACGTCTGCAGGCGAAAATGTTTGGTCAGCTTTCGACAGACCCAGAGCAAGCTGCTGCACAGGTAAGGCTG
GCGATGTCATCCCCTCAGTGGCAGCAAAAACAGCAACAGTTGGTTGCAGCATATCGCCAGGTGGTACATG
CCTGGGAGCTTGGGATCCGCAAAGTGCCCGCTGTCGTTTTTGACGATAGGGATGTGGTCTATGGCACAAC
CGATGTAGCGCAGGCACTGCGGCTGCAAGCTGGAGGTGATCAGTGA