SecReT4
Protein ID: 238918316
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0353
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]355672..356664 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDC5BDH9
KEGG IDeic:NT01EI_0353
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.8e-91, Aligned region: 37..319
Protein Sequence: 330 a.a.     [Download]
>gi|238918316|ref|YP_002931830.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MNQPPSWFRRTLCSAAVATVLGTASIPTALAALNTAQIVASAVTQDCISWRVSGICYWLFCSWYGCTVRT
SVKVTHFIPQTVVSTYVAPGGNPWTEMAAVSQTAGGLENAVTGALSGVTAGGANPADMKNPGQRKSNIRF
KYADAIGHPATSLIGGRIPGYSCDSAATPLMPYFLSTLDSIAWRTGVPESLYPEALVIGRREIGSQASGN
MWGNVYPRSGFVSQSDDDKASAVVAQRVADIITRTGQPHVYHELKGPRRDGYWPPGEVTENTGSKNHKWQ
RLAPSMTRSCAVFPDGSHSAASDNNAAFALWQPYSCCKRMGQKFLGSTDF
 
Nucleotide Sequence: 993 bp     [Download]
>gi|238917983|ref|NC_012779.1|:355672-356664 Edwardsiella ictaluri 93-146 chromosome, complete genome
GTGAATCAGCCTCCCTCTTGGTTCAGGAGAACGCTTTGCTCTGCCGCTGTCGCCACCGTTTTGGGTACTG
CGTCAATACCTACCGCGCTCGCTGCACTGAATACCGCGCAAATCGTGGCTAGTGCGGTGACGCAGGATTG
CATCAGCTGGCGGGTAAGCGGTATCTGCTACTGGCTGTTCTGTTCCTGGTATGGTTGTACGGTACGTACC
TCTGTGAAAGTGACTCACTTTATTCCTCAGACGGTGGTTTCGACTTATGTCGCGCCTGGAGGAAATCCTT
GGACAGAGATGGCTGCTGTCAGTCAGACAGCGGGCGGGTTAGAGAATGCTGTTACTGGCGCGTTGTCTGG
AGTGACGGCCGGTGGCGCCAATCCGGCAGACATGAAGAATCCGGGGCAGCGTAAATCCAATATTCGTTTC
AAATATGCGGATGCTATTGGTCATCCGGCCACATCGCTTATCGGGGGCCGTATCCCAGGGTATTCCTGTG
ATAGCGCAGCTACACCTCTGATGCCGTATTTCCTCAGTACGTTGGATTCCATTGCCTGGCGAACGGGCGT
ACCGGAATCGTTGTATCCCGAAGCGCTGGTCATTGGCCGACGAGAAATTGGCAGTCAGGCATCTGGCAAC
ATGTGGGGCAATGTTTATCCACGCTCCGGGTTTGTTAGCCAGAGCGATGATGACAAAGCATCGGCGGTAG
TAGCGCAACGTGTTGCAGACATCATTACTCGCACAGGGCAACCACATGTTTATCACGAGCTGAAAGGGCC
CCGCCGCGATGGATACTGGCCGCCGGGAGAAGTCACGGAAAATACCGGTTCCAAAAATCATAAATGGCAA
CGCCTGGCTCCAAGTATGACACGAAGTTGCGCGGTATTTCCGGACGGGAGTCACAGCGCGGCCAGTGATA
ACAACGCGGCTTTTGCGTTGTGGCAACCCTACAGTTGTTGCAAGCGCATGGGACAGAAATTCTTGGGCAG
TACTGATTTTTGA