SecReT4
Protein ID: 238918319
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0356
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]358483..360018 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDC5BDI2
KEGG IDeic:NT01EI_0356
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.8e-115, Aligned region: 8..487
Protein Sequence: 511 a.a.     [Download]
>gi|238918319|ref|YP_002931833.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MTTNSYLEYFLTLLGWLVNNGLWDVLVSTGLFALPLAFKVASIWLKVREEGEDEGNKGMLSLPRIENALY
GAFFVMIACCVPLIQVSLSTLEFDKSRGKTCGTWTPKAPNETGYSGIISSMDGESAAAPVWWVLVHKLSK
GVTQAAVASIPCRPDLRQLRFEVQRTFIENRALADELQDFTNDCYSLALYQWKRRDQGQTTDKATLSDLS
WIGSSTFLKGDYTTLQSKLPRGMFSWSDARDSGRPNTGNGGYPYCSEWWSAADTGLKARVMKQVDDSYWL
RLSAAMKMIGSSQTDYQEEVIRRLVSPANLTVSHGGEVYNGYGGNAGMTAMNAISRVAGTAGASVASLGA
FPALDAMRQALPMVQAVILMAIYIMVPLILTFAAYEFKTVITLTLVIFAVNFLTFWWELARWLDSWLLTA
LYSSDTHSRFNMMGFQNTSDDLIMNLVMGTMFLMLPAVWIGALSWAGVHLGGAISNSMKTGTDKATQSSE
KGGKVAEQAVSSFAGGMMKGK
 
Nucleotide Sequence: 1536 bp     [Download]
>gi|238917983|ref|NC_012779.1|:358483-360018 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGACAACGAACAGCTATCTGGAGTATTTCCTGACCCTGCTGGGTTGGCTGGTCAATAATGGTCTCTGGG
ATGTCCTTGTCAGTACCGGACTCTTTGCGCTGCCACTGGCCTTTAAGGTCGCGAGTATCTGGCTGAAGGT
TCGTGAAGAAGGCGAGGATGAAGGTAACAAGGGCATGCTGTCACTGCCCCGTATCGAGAATGCGCTTTAT
GGTGCGTTCTTTGTGATGATTGCCTGTTGCGTGCCGCTGATTCAGGTAAGTCTGAGTACACTGGAGTTTG
ATAAAAGCCGGGGGAAAACATGCGGGACCTGGACCCCAAAAGCGCCGAATGAAACTGGCTACAGCGGCAT
TATATCTAGCATGGATGGAGAAAGCGCCGCAGCACCAGTTTGGTGGGTGCTGGTCCATAAGCTCTCCAAA
GGCGTGACACAGGCAGCTGTGGCCAGTATTCCTTGTCGGCCAGATCTCAGGCAACTGCGGTTTGAGGTTC
AACGGACGTTCATTGAGAATCGTGCTCTGGCTGATGAGTTGCAGGATTTTACCAACGACTGCTATTCGCT
GGCGCTTTACCAGTGGAAACGGCGTGACCAGGGGCAGACAACAGATAAGGCGACTTTGTCAGACCTCAGT
TGGATAGGTAGCAGTACCTTTCTTAAAGGAGACTATACCACCCTGCAGTCGAAATTGCCGCGCGGGATGT
TCTCCTGGAGTGACGCCCGTGACAGTGGTCGGCCGAATACCGGTAATGGGGGATACCCTTACTGTTCTGA
GTGGTGGTCGGCAGCAGATACTGGCCTGAAGGCCAGGGTGATGAAGCAGGTTGATGACAGCTACTGGCTG
CGGTTATCTGCGGCGATGAAGATGATTGGCAGCAGCCAGACTGATTATCAGGAAGAGGTGATCCGCCGGC
TTGTCAGCCCGGCGAACCTGACGGTATCGCATGGAGGTGAAGTATATAACGGCTATGGTGGTAATGCGGG
TATGACGGCAATGAATGCGATTTCCCGTGTTGCCGGAACGGCAGGCGCTTCGGTGGCCTCACTGGGCGCG
TTCCCGGCTCTGGACGCGATGCGTCAGGCATTGCCGATGGTGCAGGCCGTTATACTGATGGCCATTTATA
TTATGGTGCCATTAATCCTGACCTTTGCGGCTTATGAATTCAAAACGGTGATCACCCTGACGCTTGTCAT
TTTTGCTGTGAACTTCTTGACGTTCTGGTGGGAACTGGCCCGCTGGCTCGACAGTTGGTTGCTGACGGCG
CTATACAGTTCTGATACCCACTCACGCTTTAATATGATGGGATTCCAGAATACATCGGATGATCTGATTA
TGAATCTGGTTATGGGGACGATGTTTCTCATGTTGCCGGCTGTGTGGATAGGGGCATTGAGTTGGGCGGG
TGTTCATTTGGGAGGGGCTATTAGCAACAGTATGAAAACCGGAACGGACAAAGCTACGCAATCAAGTGAA
AAAGGAGGAAAAGTTGCAGAGCAAGCTGTTTCATCTTTCGCGGGTGGCATGATGAAAGGTAAATAA