SecReT4
Protein ID: 256367579
T4SS name [ID]Tra_I [166]
Gene symboltrbA
Locus tagpEK204_p47
StrainEscherichia coli plasmid pEK204 (NC_013120)
Repliconplasmid pEK204 [GenBank: NC_013120] [Browse all T4SS(s) in this replicon]
Location [Strand]42987..44195 [-]
ProductTrbA protein
Component typeTrbA_I
UniProt IDC7SA39
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 402 a.a.     [Download]
>gi|256367579|ref|YP_003108138.1| TrbA protein [Escherichia coli]
MSYNRQPVAEDPMQIWGAVGVLLILLLFVIWLFLPEVVYASCLILHTLWGLVDWGPFHNYAAPRYNLLAM
TGNNAANISYSQWVNVMEQTIGILWMYLLPVTLWCLWEWYQHPGQSRFTRRPVDITRLPHIFASLSPAIA
PVLEDGDPEKLFHGGKRPERRVALTPEAFVEQHTLITNMQLDVAAARRCFMAQLGKPLTSWKDMAPHEKA
LFAIFGLQYFLDDRKAALKLMDTLNLSCRIKSKRDSGKFCTPVYSLAKSAFQRVIKSNGAQQWLKQHRYV
RSGLVWLYAHDLRLTPPNWIWLKGVDRTLFYALHRANTTKGFIEGAGVVAVARAEAEAMRFGLPCPEPCV
DEAVEGLRRDMLSLGLIWDEPQPDRDRKRRILTNWSLTEDILPRTPATDNEF
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|256367532|ref|NC_013120.1|:c44195-42987 Escherichia coli plasmid pEK204, complete sequence
ATGTCTTACAATCGACAGCCTGTCGCAGAAGATCCTATGCAGATATGGGGCGCTGTTGGTGTCCTTCTTA
TCCTGCTGCTATTCGTCATATGGTTATTCTTGCCGGAAGTGGTTTACGCCAGCTGCCTGATTCTTCATAC
CTTATGGGGACTGGTTGACTGGGGACCATTTCATAACTATGCAGCACCACGATACAACCTGCTTGCCATG
ACCGGTAACAACGCCGCCAACATAAGCTATAGCCAGTGGGTTAACGTCATGGAGCAGACCATAGGTATTT
TGTGGATGTACCTCTTACCTGTGACACTCTGGTGTTTGTGGGAATGGTATCAACATCCGGGACAAAGCCG
TTTCACCCGCAGACCAGTAGATATTACCCGACTGCCACACATCTTTGCTTCGTTGTCCCCTGCTATCGCC
CCTGTACTGGAAGATGGTGATCCGGAAAAACTCTTTCATGGTGGTAAACGACCTGAACGGCGGGTTGCTC
TCACCCCGGAAGCATTTGTCGAACAGCATACTCTCATCACCAATATGCAGCTCGATGTTGCAGCTGCAAG
ACGATGTTTCATGGCCCAGTTGGGTAAACCTTTAACGTCCTGGAAAGACATGGCACCACATGAAAAAGCG
CTCTTTGCCATATTTGGCCTTCAGTATTTCCTGGATGATCGGAAGGCAGCATTAAAGCTCATGGATACAC
TGAACCTCTCATGCAGAATTAAAAGCAAACGGGACAGCGGGAAATTCTGTACCCCTGTTTATTCACTGGC
CAAATCAGCTTTCCAGAGAGTGATTAAAAGCAACGGAGCACAGCAATGGCTGAAACAACATCGCTACGTC
CGCAGTGGGCTGGTCTGGCTGTATGCACATGACCTGCGGCTTACGCCACCCAACTGGATTTGGCTGAAAG
GCGTGGACAGAACGCTGTTTTATGCATTACACCGCGCCAATACCACGAAAGGATTTATTGAAGGCGCTGG
CGTGGTGGCCGTTGCACGTGCAGAGGCCGAAGCCATGCGTTTTGGCCTTCCCTGCCCTGAACCCTGTGTT
GATGAAGCGGTGGAAGGCTTACGGCGGGATATGCTCAGTCTCGGTCTTATCTGGGATGAACCACAACCAG
ATCGCGACCGGAAACGCCGCATCCTGACCAACTGGTCCCTCACCGAAGACATCCTGCCCCGTACACCTGC
TACAGACAACGAATTCTGA