SecReT4
Protein ID: 256367584
T4SS name [ID]Tra_I [166]
Gene symboltraY
Locus tagpEK204_p52
StrainEscherichia coli plasmid pEK204 (NC_013120)
Repliconplasmid pEK204 [GenBank: NC_013120] [Browse all T4SS(s) in this replicon]
Location [Strand]48626..50863 [-]
ProductTraY
Component typeTraY_I
UniProt IDC7SA44
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 745 a.a.     [Download]
>gi|256367584|ref|YP_003108143.1| TraY [Escherichia coli]
MSPSPLIKSCVAFAHTQFYSGVTVKILLRALCAGLAISSLPAMASVTYQDIVSAATNPDDLSRQALVTIF
GDVVTNPLSTSAPTLIGSMFGAFNSIIAVLAVVWFMFIGIRHVVRSGHQGQVFSTGRDIVGTLSVVAGFL
MIVPTGNGWSIAQLIMLWGASIMGVGSANVMVQLAADNIANGYSMTVQPVQASTRTAARGIFEMELCKYA
VNAGLNDFNQTVKSSTSLMTESAKTASGNYTVTVSNGSGICGSASLSVEGNGTTDQSTIGKFFNPFSKNE
YSGVISAQRAAMDNMISDMDNAASEFVTTFLEKRNSGNGTLPDIETRIQKAADEYERAVQKSLPTDNGEQ
SRKEALKSYLTTYGWVTLGAWYQTFATANQRLAELADRAPAVTSMSSLGEVGDTDLFSAVMSAYRTQLQN
SSYTPPLGTVVSSSEQRMANAQDPKSALSEIMGPLVSLTNRIATETSGTGTTSAQINPLIKMKNIGDITM
VSAEGIWTIYTTARVVVAGGKDSILVKFFNSLTGAASMLTALFEALAPPVYFLLFLMFCAGFSLSIYLPF
IPFIFWMTGIGNWIVSVLIGCTAGPLWAATHLGTSEDRGSRAAYGYIYLIDSMIRPPIMVFGFFFASVAI
IAVGTILNALFGAALVNVQFNSLTGIFSLAGFLLIYARICTTTVAAIFALQAYLPDHVINFLGGRDGANT
LGSMANSVKEIFIGGSRNIRHTPGMKTDRLKDNTKGSDDKDGIKG
 
Nucleotide Sequence: 2238 bp     [Download]
>gi|256367532|ref|NC_013120.1|:c50863-48626 Escherichia coli plasmid pEK204, complete sequence
ATGTCGCCATCCCCCTTAATTAAATCCTGTGTGGCCTTTGCCCATACGCAATTCTATTCCGGAGTTACTG
TGAAAATTTTACTTCGCGCACTCTGTGCAGGCCTTGCTATATCCTCACTGCCGGCAATGGCTTCAGTGAC
CTATCAGGATATTGTGTCTGCCGCAACCAATCCTGACGATCTGTCCCGTCAGGCGCTGGTCACGATATTC
GGTGATGTAGTCACCAATCCACTGTCAACCAGCGCCCCCACTCTGATCGGAAGCATGTTCGGGGCGTTCA
ACAGTATCATCGCCGTACTTGCCGTTGTCTGGTTTATGTTCATTGGTATCCGTCATGTTGTGCGTTCGGG
GCATCAGGGACAGGTATTCAGCACCGGACGCGATATCGTCGGCACACTGAGTGTCGTTGCAGGTTTTCTG
ATGATCGTTCCAACCGGAAATGGCTGGAGTATCGCTCAGCTCATTATGTTATGGGGCGCATCGATAATGG
GGGTTGGGTCCGCCAATGTGATGGTGCAACTTGCCGCTGATAATATCGCAAATGGTTATTCAATGACTGT
ACAGCCAGTTCAGGCATCCACACGAACAGCAGCGCGTGGCATTTTTGAAATGGAACTGTGTAAGTATGCG
GTTAACGCAGGACTAAATGATTTTAATCAGACGGTCAAATCCTCGACTTCACTGATGACAGAATCAGCTA
AAACCGCCAGTGGTAATTACACTGTCACGGTATCCAATGGCAGCGGTATCTGTGGTTCAGCCAGCCTGTC
AGTAGAAGGAAACGGAACAACAGATCAATCGACGATTGGAAAATTCTTTAATCCCTTCAGTAAAAACGAA
TACAGCGGTGTTATCTCAGCACAACGTGCAGCCATGGATAATATGATTAGCGACATGGACAACGCTGCCA
GTGAGTTTGTGACAACATTTCTGGAAAAAAGAAATTCTGGCAACGGAACACTGCCGGATATCGAGACACG
AATTCAGAAAGCAGCCGACGAATACGAACGTGCTGTGCAAAAATCGCTACCCACTGATAACGGAGAGCAA
TCCAGAAAAGAGGCTCTTAAATCTTATCTCACAACCTACGGGTGGGTAACGCTTGGCGCATGGTATCAGA
CCTTTGCCACTGCTAACCAGCGTCTGGCAGAGCTGGCTGACAGAGCTCCAGCTGTAACTTCAATGTCATC
ACTGGGAGAAGTTGGTGATACTGACTTATTCAGTGCGGTCATGAGTGCCTATAGGACGCAACTGCAGAAT
TCCTCCTATACGCCACCGCTGGGCACAGTAGTATCATCCAGTGAACAACGCATGGCAAATGCACAAGATC
CGAAATCTGCCTTGTCTGAAATTATGGGCCCCCTTGTTAGTCTCACTAACAGGATTGCAACGGAAACAAG
TGGCACAGGCACAACCAGTGCTCAAATTAATCCTCTGATAAAAATGAAAAATATCGGAGATATAACAATG
GTAAGTGCAGAAGGAATCTGGACTATATATACAACGGCCAGAGTTGTCGTTGCCGGTGGCAAAGATTCAA
TTCTTGTAAAATTCTTTAACTCACTAACAGGTGCCGCTTCGATGCTTACCGCGCTGTTTGAAGCACTTGC
ACCACCTGTTTATTTTCTTTTGTTCCTGATGTTCTGTGCTGGATTTTCCTTATCAATTTACCTGCCATTC
ATTCCGTTTATTTTCTGGATGACAGGCATCGGGAACTGGATAGTCAGCGTATTAATAGGATGTACCGCCG
GGCCGCTGTGGGCTGCAACACATCTCGGGACATCAGAAGACAGAGGAAGTCGGGCAGCCTACGGTTATAT
ATACTTAATTGATAGTATGATAAGGCCGCCCATCATGGTCTTTGGTTTTTTCTTTGCTTCTGTAGCCATC
ATCGCCGTAGGCACAATACTGAATGCATTATTTGGCGCTGCCCTGGTTAACGTACAGTTCAATTCGCTGA
CCGGTATTTTCAGTCTTGCTGGTTTCTTGCTGATATACGCCAGAATTTGTACAACCACTGTAGCTGCCAT
ATTTGCCCTTCAGGCCTACCTACCTGATCATGTTATTAACTTCCTAGGGGGACGTGATGGAGCCAACACG
CTTGGCAGCATGGCAAATTCTGTTAAAGAAATATTTATTGGAGGAAGTCGCAATATCCGACATACTCCTG
GAATGAAAACAGATCGTCTTAAAGATAATACAAAAGGAAGTGACGACAAGGACGGAATAAAAGGATAA