SecReT4
Protein ID: 256367591
T4SS name [ID]Tra_I [166]
Gene symboltraR
Locus tagpEK204_p59
StrainEscherichia coli plasmid pEK204 (NC_013120)
Repliconplasmid pEK204 [GenBank: NC_013120] [Browse all T4SS(s) in this replicon]
Location [Strand]57457..57861 [-]
ProductTraR protein
Component typeTraR_I
UniProt IDC7SA51
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|256367591|ref|YP_003108150.1| TraR protein [Escherichia coli]
MSRIRVVAARLYAAFIHAQLFVMSCRSKLTKYLLLIPMMLLPKAVLADGDLADMVRNVGEGAKTAQSSSI
TIAQFIGVILFLGGLIGLKKVGKQGGMGLAGCIVSIVIGAVLVAGPEMMSRSQKQLGISSISIG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|256367532|ref|NC_013120.1|:c57861-57457 Escherichia coli plasmid pEK204, complete sequence
ATGTCACGTATTCGTGTCGTGGCGGCTCGTCTGTACGCCGCATTTATCCATGCACAACTGTTTGTAATGT
CATGCCGGAGCAAACTGACTAAGTACCTGCTGCTCATTCCCATGATGTTGCTGCCCAAAGCCGTTCTTGC
CGATGGAGATCTTGCCGATATGGTTCGCAATGTTGGTGAAGGTGCTAAAACAGCACAGTCATCATCAATC
ACTATTGCGCAGTTCATCGGCGTAATTCTGTTTCTCGGGGGCCTGATTGGCCTGAAAAAAGTTGGGAAAC
AAGGGGGGATGGGACTGGCTGGTTGCATTGTATCTATCGTCATTGGGGCGGTACTTGTCGCCGGACCTGA
AATGATGAGTCGCAGCCAGAAACAGTTGGGGATTTCCTCAATTTCCATTGGCTAA