SecReT4
Protein ID: 256367592
T4SS name [ID]Tra_I [166]
Gene symboltraQ
Locus tagpEK204_p60
StrainEscherichia coli plasmid pEK204 (NC_013120)
Repliconplasmid pEK204 [GenBank: NC_013120] [Browse all T4SS(s) in this replicon]
Location [Strand]57912..58439 [-]
ProductTraQ protein
Component typeTraQ_I
UniProt IDC7SA52
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|256367592|ref|YP_003108151.1| TraQ protein [Escherichia coli]
MNMDALTAIENFASSIFSAGMDFLFTWGEFIGVISMITLFARARSAGPVKMSPGKFIAGMLTSCMLVSLP
AMINAGGVQMGFRADSFGPIAYVQPQTFGAAAGAANAVLSLAKLAGVGFVMNGISIWRKAGLDGHTALSA
SESVSKGNVKFIAGVLLVFIDRVLNALLASIGIVF
 
Nucleotide Sequence: 528 bp     [Download]
>gi|256367532|ref|NC_013120.1|:c58439-57912 Escherichia coli plasmid pEK204, complete sequence
ATGAACATGGATGCCCTGACCGCCATTGAGAACTTTGCCAGCAGTATTTTCAGTGCCGGAATGGATTTCC
TGTTTACCTGGGGAGAATTCATCGGGGTGATCAGCATGATTACCCTGTTTGCCCGCGCCCGTTCAGCCGG
TCCGGTAAAAATGTCTCCCGGAAAATTTATTGCGGGGATGTTAACCAGCTGCATGCTCGTATCACTCCCG
GCAATGATTAACGCCGGAGGCGTACAAATGGGATTCAGGGCTGACTCATTTGGTCCGATTGCATATGTAC
AACCTCAGACGTTTGGCGCTGCTGCTGGCGCAGCAAATGCAGTTCTGTCGCTGGCCAAGCTGGCCGGTGT
GGGATTTGTCATGAACGGGATATCCATCTGGCGCAAGGCCGGACTCGATGGACATACCGCACTGAGTGCC
AGTGAATCCGTCAGTAAAGGAAACGTCAAATTTATTGCCGGCGTCCTGCTGGTCTTTATCGATCGTGTCC
TCAATGCCCTGCTGGCAAGCATTGGAATCGTCTTCTGA