SecReT4
Protein ID: 260752020
T4SS name [ID]Tra_F [570]
Gene symbol-
Locus tagECO111_p1-008
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_1 [GenBank: NC_013365] [Browse all T4SS(s) in this replicon]
Location [Strand]5416..6774 [+]
Productputative plasmid transfer protein
Component typeTraB_F
UniProt IDC8UQD2
KEGG IDeoi:ECO111_p1-008
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.5e-39, Aligned region: 240..444
Protein Sequence: 452 a.a.     [Download]
>gi|260752020|ref|YP_003237535.1| putative plasmid transfer protein [Escherichia coli O111:H- str. 11128]
MDIKKAWENKTVRISVIGAALMVLIVVISQSIFTTPVKKEKKTQKKDMQTGFLIDDSQMNKLSNEESQKT
YNEMVRQNRIDQNAAKADRDKAEKAQQENKAQIASLASQVQQLTTQLTEMQTSRNGNRNLDAGGPRNNVN
EQAPAKPYQLNPNAAVNGVSSGYAPISPTRNSPMRTITQSSIKTNGTDGVIQVMPISENRIREGREVVAG
SEKAPTRTIRGDGTAPVDSKARHAARKDEMFLPATSIITGVLITGLEAPTSLSSKAEPMPVTMRIKKDII
MPNNYTMDLRDCNLLGSAVGDLASQRAYIRATSISCVNSKGKAFDVIVEAYAVSENDGKNGIRGNLISRN
GNAIAGSAFAGGLSALAGSLSPSKVSSLNIDPNSTAQYQSPNIGALGALAGAGAAQGGLNRLVDYYTSIA
EQQWPIVEISPGRPITFVVQKGATIPTNLTSR
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|260752012|ref|NC_013365.1|:5416-6774 Escherichia coli O111:H- str. 11128 plasmid pO111_1, complete sequence
ATGGACATTAAAAAGGCCTGGGAAAATAAAACTGTCAGAATCTCAGTAATTGGTGCTGCATTGATGGTAT
TGATTGTTGTCATCAGTCAATCAATCTTTACCACACCAGTTAAAAAAGAGAAGAAAACCCAGAAAAAAGA
TATGCAAACTGGATTCCTTATTGATGATTCACAAATGAACAAGCTGAGTAATGAGGAAAGCCAGAAGACT
TATAACGAAATGGTAAGGCAGAACCGTATTGACCAGAACGCTGCCAAGGCTGACCGTGACAAAGCTGAAA
AGGCTCAGCAAGAAAACAAAGCACAGATAGCCAGTCTTGCTTCGCAAGTTCAGCAACTCACTACGCAGTT
GACTGAAATGCAGACCTCAAGAAATGGTAATCGCAATCTCGATGCAGGCGGACCACGCAACAACGTCAAT
GAACAAGCCCCAGCAAAGCCATACCAGCTTAATCCAAATGCAGCGGTGAACGGGGTTAGTTCTGGATACG
CACCTATATCTCCGACCCGAAACAGTCCAATGCGGACAATAACACAGAGTTCAATTAAGACAAACGGCAC
TGATGGTGTCATTCAGGTGATGCCGATATCAGAGAACCGGATCAGAGAGGGGCGCGAGGTTGTTGCGGGA
AGTGAAAAGGCCCCAACGCGAACTATTCGCGGCGATGGGACTGCACCTGTTGATAGTAAAGCTCGTCATG
CGGCCCGTAAGGATGAAATGTTTCTTCCAGCGACGTCAATTATTACTGGGGTGCTAATTACCGGGCTGGA
AGCTCCAACGAGTTTGTCCTCTAAAGCAGAACCGATGCCGGTTACCATGCGCATTAAAAAAGACATCATC
ATGCCTAACAATTACACGATGGATTTGCGTGATTGTAATTTATTGGGTTCTGCTGTGGGGGATCTGGCAT
CTCAGCGTGCGTACATTAGGGCAACCTCCATATCGTGTGTCAACTCGAAAGGAAAAGCATTCGACGTAAT
AGTGGAAGCTTATGCGGTTAGTGAAAATGACGGGAAAAATGGCATTCGTGGGAATCTGATAAGCAGAAAT
GGAAATGCGATTGCAGGTTCTGCGTTTGCAGGAGGGCTGTCAGCATTGGCGGGGAGTCTGAGTCCATCAA
AGGTGTCTTCGCTTAATATAGATCCAAACTCTACGGCACAATACCAATCGCCAAACATAGGTGCATTAGG
AGCGCTGGCCGGAGCCGGTGCAGCTCAGGGGGGGCTAAACCGTCTTGTGGACTACTATACGTCAATAGCT
GAGCAGCAGTGGCCAATTGTAGAAATTAGCCCAGGGCGCCCAATTACTTTTGTCGTTCAAAAAGGGGCGA
CAATACCTACAAACCTGACAAGCCGCTGA