SecReT4
Protein ID: 260752041
T4SS name [ID]Tra_F [570]
Gene symbol-
Locus tagECO111_p1-031
StrainEscherichia coli O111:H- str. 11128
Repliconplasmid pO111_1 [GenBank: NC_013365] [Browse all T4SS(s) in this replicon]
Location [Strand]32310..35486 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDC8UQF3
KEGG IDeoi:ECO111_p1-031
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 5.6e-24, Aligned region: 541..710
TraN [PF06986], Evalue: 5.6e-24, Aligned region: 868..935
Protein Sequence: 1058 a.a.     [Download]
>gi|260752041|ref|YP_003237556.1| plasmid transfer protein TrhN [Escherichia coli O111:H- str. 11128]
MKHRKIISSAIIASMIANTMSWAFYVSLINIALTPKIFAADAIFDQLENNFNLANPNANRNATTSAQDIV
EKYKNADSGENLSGKISEKYVGKAESTNLNVGKYGTPNSNESVMSNAVSDGKSIGKAVQLPSMSGGTINS
NYTKEGAKLLSRDSSGNIGISNNPNTTAGTKTSTGELFSSEQKHSDVQFNAGGRYGDENGFINDIKNRKS
QLFEAQSYDGVAYRTLVNANKENPASTIKPNDPMFNAGRNEIGNAVAGTGNWLQNCNTETSKQTITTHYP
DYKEFYCNSPKKDNFNSCTITRDFSVPVYISGGNGDMSMCGDNCVRVWFGRRDDNYWNDGVYDNSLTLKF
HPDAKLATAKIINAEWDDHMRVTLDGTQIFAHIDGAYRSSNYPSPQGQWELKKSWKLDKVYDITEQVKTS
VYQEQDREVTMASRVWVGGGGEGYFEVEMTFENMKLEDKHIQEPAGCFDAVQTPNSFCRFDRFVNMDVGT
KRLPESVLKMATPLYKGDTGYLTWKTNLEGYFCDPLAKEKLCSYDAKGNIMKDPTGKDLCYNYDDIKNMP
DACSTYKNDAACVLDNQTCAEGWFDEGTNTCYMYEQKYTCDRGKDVVREVESQTNSCVGMIPCSGGTCET
GPKEENKDFGKVAAYSNMVQYMQGEAKCEDPNDPNSCSVFEGKAEWCGRSVGFVNGLAKTDCCEKPQGAA
GSLEAIMLAGSMIRNTNWTRVNAQLVNWTGGESGTWASMANSVGEWTASAGKTVGQMWNNVTSSITSVYE
NVAGNLGRTVGSSAAGESGQLAKETMSSFGLGKLKQMAMEKAYDLLPDTVRDFVFKNVATTGGEIVFSAA
VQNFMLALNVIGWIYTAYQVTKMLLEMLVACDQKEMEASIHKNQKSCFTLDTNRCVKYLNLGFTKKCVKK
ATDMCCYNSMLSRVIMQQAYPQLGIDPVTSNCVGLSIGQIQKLDFDKIDLTEWINDAVQVGEVPDQYATF
SESSITANLPFKNENYQLPSERTKDAMGGEENMIKARQENAQAIKEENVDCSYLPRPAICEVGSTYVDPI
TGKEIPKY
 
Nucleotide Sequence: 3177 bp     [Download]
>gi|260752012|ref|NC_013365.1|:32310-35486 Escherichia coli O111:H- str. 11128 plasmid pO111_1, complete sequence
ATGAAACATAGAAAAATAATTTCTTCAGCAATTATTGCGTCTATGATAGCTAATACTATGAGTTGGGCAT
TTTACGTTTCGCTCATAAACATTGCGTTAACGCCTAAAATATTTGCGGCAGATGCGATTTTTGACCAGCT
TGAAAACAATTTTAACCTTGCCAATCCCAACGCCAACCGGAACGCAACCACCAGTGCTCAGGATATTGTG
GAAAAGTATAAAAATGCTGATTCCGGGGAAAATCTGAGCGGCAAAATTTCCGAGAAATATGTTGGTAAAG
CAGAGTCAACAAACCTAAATGTTGGGAAGTACGGGACGCCGAACTCAAATGAAAGTGTTATGAGTAATGC
GGTGTCCGACGGGAAATCGATCGGTAAGGCTGTACAATTACCTAGCATGTCGGGCGGTACAATTAACTCG
AATTATACGAAAGAGGGGGCAAAGTTACTTTCTAGGGACAGCAGCGGTAATATTGGAATAAGTAACAACC
CGAATACAACGGCAGGTACCAAAACCAGTACAGGGGAACTATTCAGCTCAGAGCAGAAGCACAGTGATGT
TCAGTTCAATGCTGGTGGCCGGTATGGAGATGAAAATGGCTTCATCAATGACATCAAAAATCGAAAAAGT
CAGCTGTTTGAAGCGCAAAGTTATGATGGAGTCGCCTACCGTACTCTGGTGAATGCAAATAAAGAAAACC
CAGCATCTACTATTAAACCTAACGACCCTATGTTCAATGCGGGTCGTAACGAAATAGGAAATGCTGTAGC
TGGTACAGGAAACTGGCTACAGAATTGTAATACGGAAACATCAAAACAAACAATTACTACGCACTATCCA
GATTACAAAGAGTTTTACTGCAATTCACCCAAGAAAGATAATTTTAACAGTTGCACGATAACTCGTGATT
TTTCCGTGCCGGTTTATATCTCAGGTGGTAATGGTGATATGTCCATGTGCGGAGATAATTGTGTGAGAGT
CTGGTTTGGCAGAAGGGACGACAACTATTGGAACGATGGAGTCTATGACAACTCATTAACCTTAAAATTC
CATCCAGATGCAAAGCTCGCAACTGCGAAAATAATTAACGCAGAGTGGGATGACCATATGAGGGTCACGC
TTGATGGTACACAGATTTTTGCTCATATAGATGGAGCATATAGAAGTAGCAATTATCCATCTCCACAAGG
TCAATGGGAGTTAAAGAAATCCTGGAAGCTCGATAAAGTCTACGATATTACTGAACAAGTAAAAACCTCT
GTATATCAGGAGCAGGATCGTGAAGTGACTATGGCTTCGCGCGTATGGGTTGGCGGTGGTGGGGAAGGCT
ATTTTGAAGTTGAGATGACTTTTGAAAATATGAAGTTGGAGGATAAACATATACAGGAGCCCGCAGGATG
TTTTGATGCAGTACAAACGCCGAATTCATTCTGTCGGTTTGACAGGTTTGTCAACATGGATGTTGGTACA
AAGCGACTCCCGGAAAGTGTGCTTAAGATGGCCACACCGCTTTACAAAGGTGATACAGGATACTTAACCT
GGAAAACAAACCTTGAAGGCTATTTCTGTGATCCCCTGGCGAAGGAAAAACTGTGCTCTTATGATGCGAA
GGGAAACATCATGAAAGACCCCACAGGCAAAGACCTTTGCTACAACTACGACGATATAAAAAATATGCCT
GACGCATGCAGCACATATAAAAATGATGCTGCGTGTGTGCTAGATAATCAGACATGTGCTGAAGGTTGGT
TCGATGAAGGCACAAATACTTGCTACATGTATGAGCAGAAATATACATGTGACAGAGGGAAAGACGTAGT
CAGAGAGGTAGAGTCACAGACTAACTCCTGTGTAGGTATGATCCCATGTTCTGGCGGAACATGTGAAACA
GGCCCAAAAGAAGAAAACAAAGATTTTGGGAAAGTGGCCGCGTACTCCAATATGGTTCAGTACATGCAAG
GTGAAGCAAAATGCGAAGATCCAAACGACCCTAACTCCTGCTCTGTCTTTGAAGGGAAAGCAGAGTGGTG
CGGCAGGTCCGTTGGTTTTGTGAACGGACTGGCCAAAACAGATTGCTGCGAAAAGCCGCAGGGTGCTGCT
GGGTCACTGGAGGCGATAATGCTGGCCGGGTCGATGATCCGAAACACGAACTGGACCCGAGTGAATGCTC
AACTGGTAAACTGGACTGGAGGGGAGAGCGGAACCTGGGCATCAATGGCTAACTCAGTGGGTGAATGGAC
TGCATCGGCAGGTAAAACTGTCGGACAAATGTGGAACAATGTGACCAGTTCAATAACCAGCGTTTACGAA
AACGTGGCCGGTAACCTTGGCCGAACAGTAGGATCATCCGCTGCTGGTGAAAGTGGTCAGCTTGCTAAGG
AGACTATGAGTTCATTCGGGCTTGGTAAACTTAAGCAGATGGCCATGGAAAAAGCCTATGACCTGCTTCC
CGATACAGTTCGAGACTTCGTATTTAAAAATGTAGCGACAACGGGTGGAGAAATAGTCTTTTCTGCTGCT
GTTCAAAACTTTATGCTTGCATTAAATGTAATCGGCTGGATTTATACGGCATATCAAGTCACAAAAATGC
TGCTTGAAATGCTGGTGGCCTGCGATCAAAAAGAAATGGAAGCATCTATTCACAAAAATCAGAAATCCTG
TTTTACACTGGATACAAACCGTTGTGTTAAATATCTGAATCTGGGATTTACAAAGAAATGTGTTAAAAAA
GCAACAGACATGTGCTGTTACAATTCAATGTTATCTCGCGTTATTATGCAGCAGGCCTACCCGCAGCTTG
GAATAGACCCGGTTACTTCAAACTGCGTTGGCTTATCAATAGGGCAGATCCAAAAGTTAGATTTTGACAA
GATTGATTTAACAGAATGGATTAACGATGCTGTTCAGGTCGGAGAAGTACCGGACCAGTACGCTACATTC
TCAGAATCGTCAATAACAGCAAATTTGCCATTTAAAAACGAGAATTATCAACTTCCATCAGAAAGAACAA
AAGATGCAATGGGAGGAGAGGAGAATATGATAAAAGCCAGACAGGAAAACGCTCAGGCCATTAAAGAGGA
GAACGTAGACTGTAGCTATCTTCCACGCCCTGCGATTTGTGAAGTTGGGTCAACTTATGTAGATCCAATT
ACAGGTAAGGAAATACCAAAATATTAA