SecReT4
Protein ID: 268507247
T4SS name [ID]Tra_F [532]
Gene symboltraV
Locus tagpEntH10407_p88
StrainEscherichia coli ETEC H10407 plasmid pEntH10407 (NC_013507)
Repliconplasmid pEntH10407 [GenBank: NC_013507] [Browse all T4SS(s) in this replicon]
Location [Strand]59962..60477 [-]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDD0Z6Y2
KEGG IDelh:ETEC_p666_0260
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.3e-40, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|268507247|ref|YP_003294047.1| conjugal transfer protein TraV [Escherichia coli ETEC H10407]
MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANEKAKKLEQSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVAPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWEKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|268507159|ref|NC_013507.1|:c60477-59962 Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence
ATGAAACAGATTTCTTTATTTATTCCTCTGCTGGGGACCTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACGGCACATC
CGGAGCAGAAACTGCTGGCACCACGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTCGTTCCGGT
CAGTTCAGTTGCACCGGTAACACCTCCCCGTCCGTTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCACCATATATTGATAATCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGAAAAACCACGTATTAATTAA