SecReT4
Protein ID: 268507253
T4SS name [ID]Tra_F [532]
Gene symboltraE
Locus tagpEntH10407_p94
StrainEscherichia coli ETEC H10407 plasmid pEntH10407 (NC_013507)
Repliconplasmid pEntH10407 [GenBank: NC_013507] [Browse all T4SS(s) in this replicon]
Location [Strand]63747..64313 [-]
Productconjugal transfer protein TraE
Component typeTraE_F
UniProt IDD0Z6Y8
KEGG IDelh:ETEC_p666_0320
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8e-70, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|268507253|ref|YP_003294053.1| conjugal transfer protein TraE [Escherichia coli ETEC H10407]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNEQRTAVTPMGFNVPFAVSQNSADASYL
QQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFFQTSVRVWPQYG
RVEIRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|268507159|ref|NC_013507.1|:c64313-63747 Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACGTCATTCAGGGGGTGAATAACTACCGCCTTCAGAATGAGCAACGCAC
TGCCGTGACACCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTG
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTCTCACCGGAAATCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGTGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAGGCGAA
ACTCATTAAAAAAGATAACGTGAATTCTGCTTTTTTCCAGACCAGTGTCCGTGTCTGGCCTCAGTATGGT
CGTGTGGAAATCCGTGGAATTCGGAAAACATGGATTGGTAACTCCGAACCTTTTACTGATATCAAACATT
ACATTCTTATTCTGAAGCGGGAGAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA