SecReT4
Protein ID: 268507256
T4SS name [ID]Tra_F [532]
Gene symboltraY
Locus tagpEntH10407_p97
StrainEscherichia coli ETEC H10407 plasmid pEntH10407 (NC_013507)
Repliconplasmid pEntH10407 [GenBank: NC_013507] [Browse all T4SS(s) in this replicon]
Location [Strand]65058..65453 [-]
Productconjugal transfer protein Y
Component typeTraY_F
UniProt IDD0Z6Z1
KEGG IDelh:ETEC_p666_0350
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 4.4e-38, Aligned region: 15..58
TraY [PF05509], Evalue: 4.4e-38, Aligned region: 70..117
Protein Sequence: 131 a.a.     [Download]
>gi|268507256|ref|YP_003294056.1| conjugal transfer protein Y [Escherichia coli ETEC H10407]
MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVKYL
TMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
 
Nucleotide Sequence: 396 bp     [Download]
>gi|268507159|ref|NC_013507.1|:c65453-65058 Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence
TTGAAAAGATTTGGTACACGTTCTGCAACAGGTAAGATGGTAAAACTAAAATTACCTGTAGATGTGGAAA
GTCTATTAATTGAGGCAAGTAACAGAAGCGGAAGAAGTCGATCGTTTGAGGCAGTAATAAGACTTAAAGA
TCATCTTCACCGCTATCCAAAGTTTAACAGGGCAGGGAATATCTATGGTAAGTCGCTGGTTAAGTATCTG
ACAATGCGTCTGGATGATGAAACTAACCAGCTACTTATTGCAGCAAAAAATCGTAGTGGATGGTGTAAAA
CAGATGAGGCTGCAGACAGAGTTATTGATCATTTGATCAAGTTTCCTGATTTTTATAACTCGGAGATATT
CAGGGAGGCAGATAAAGAGGAAGATATAACATTTAATACACTCTAG