SecReT4
Protein ID: 28868080
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0859
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]929071..931740 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDQ889A2
KEGG IDpst:PSPTO_0859
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.8e-60, Aligned region: 2..259
AAA_10 [PF12846], Evalue: 1.2e-45, Aligned region: 454..794
FtsK_SpoIIIE [PF01580], Evalue: 2.8e-05, Aligned region: 450..484
AAA_22 [PF13401], Evalue: 3e-05, Aligned region: 456..511
Protein Sequence: 889 a.a.     [Download]
>gi|28868080|ref|NP_790699.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MLLEDGKSLAAFYELTPIGTEGRDPEWLRKARDALENALQDSFDELDESPWVVQFYARDETSWADYLETL
HDYVQPRAQGTAFTEMYLQQFKHHLEAISKPGGLFEDTKVSQLPWRGQQRRVRMVVYRRCTGDGLVRGQT
PSMYLKNICERLTGGLANAGIKTRRMDRHDIRHWLLHWFNPHPEHLGSKRQDIDRFFEIVNNRKVEPPEE
GTLPLASGDDFSQCLFYSEPQSDAKKGLWYFDSRPHRVIVLDRLRDAPKTGHLTGENRKGGDALHALFDK
LPEDTVLNITLVITPQDVLEAHLEKLARKSVGDNQASALTREAVDEARKLIGRKHKLYRGNVVFYLTGKD
EQQLESRSMELANAMLSAGMEPVYPRDEVAPLSSYLRWLPASFDVNKKHALDWYTQMMLAQHVANLSPVW
GRASGTGNPGITLFNRGGAPLTFDPFNKLDRQMNAHLLLFGPTGSGKSATANNLLMQLIAIYRPRLFIIE
AGNSFGLLGDFAQKLGLTVNRLKLAPGSGVSLAPFTDAIRLVSTPDKVTILDADDIEGSDEHLQTMPEQG
EEERDVLGEMEIVARLMITGGEEREEARLTRADRSAIRHCILTAARTCFDAERAVKTEDVRDALSDAGKD
TTLPEKRRERMFEMAEAMDMFCMGADGEMFNREGTPWPEADITILDLATYAREGYNAQLSVAYISLINTV
NNIAERDQFKGRPIVNFTDEGHIITKNPLLSPYVIKITKMWRKLGAWFWLATQNIDDLPSAAAPMLNMIE
WWICLNMPPDEVEKITTFRKLTPAQKSLMLSARKESGKYTEGVVLSKSMEVLFRAVPPSLLLALAMTEPE
EKKQRYDLMQSLGVDELGAAIAIAHDLDRIRGIEPTTITFPASPLENLA
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c931740-929071 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCTGCTCGAGGACGGCAAGTCACTGGCAGCATTCTATGAACTCACCCCCATCGGCACCGAAGGTCGGG
ATCCTGAGTGGTTACGCAAAGCGCGCGATGCTCTCGAAAATGCGCTGCAGGACAGTTTTGACGAACTGGA
TGAATCGCCTTGGGTGGTGCAGTTCTACGCCAGGGATGAAACCAGTTGGGCAGATTATCTGGAGACGTTG
CATGATTACGTCCAGCCTCGCGCTCAGGGTACGGCGTTTACAGAAATGTACCTGCAGCAATTCAAACATC
ACCTAGAGGCAATCTCCAAGCCGGGAGGTTTATTTGAAGACACCAAAGTGTCTCAACTGCCCTGGCGCGG
ACAGCAACGCAGGGTTCGCATGGTCGTCTACCGGCGCTGCACCGGCGATGGACTGGTTCGTGGCCAGACG
CCGTCGATGTACTTGAAAAACATTTGCGAGCGTCTGACGGGAGGACTGGCCAACGCGGGCATCAAAACCC
GGCGCATGGATCGCCATGACATTCGTCACTGGCTGTTGCACTGGTTCAACCCGCATCCCGAACACTTGGG
ATCAAAGCGCCAGGACATCGATCGTTTCTTCGAAATCGTCAATAACCGCAAGGTCGAACCACCAGAAGAG
GGCACGCTGCCGCTGGCCAGCGGCGATGATTTCTCTCAGTGCCTGTTTTACAGCGAACCGCAATCGGATG
CCAAGAAAGGTCTCTGGTACTTCGACTCGCGCCCTCATCGGGTCATCGTCCTCGATCGCTTACGCGATGC
GCCAAAGACCGGGCACCTGACGGGTGAAAACCGTAAAGGCGGGGACGCGCTGCATGCCTTGTTCGACAAG
TTGCCCGAAGACACGGTACTCAACATCACGCTGGTGATCACTCCCCAGGATGTTCTGGAGGCCCACCTGG
AAAAACTGGCACGTAAATCAGTCGGTGACAATCAAGCCTCCGCCCTGACCCGTGAAGCGGTCGACGAAGC
CCGGAAACTGATCGGTCGAAAACACAAGCTGTACCGGGGCAACGTGGTTTTTTACTTGACCGGCAAGGAT
GAGCAACAACTGGAAAGTCGGAGCATGGAGCTTGCCAATGCCATGCTTAGCGCCGGTATGGAACCTGTCT
ATCCTCGTGATGAAGTCGCCCCTCTCAGCAGTTACCTGCGGTGGCTGCCCGCCAGTTTTGATGTGAACAA
GAAACATGCTTTGGACTGGTACACGCAGATGATGCTCGCCCAGCATGTCGCGAACCTTTCGCCAGTATGG
GGGCGTGCCAGCGGCACGGGCAACCCCGGCATAACCCTGTTCAACAGGGGCGGTGCACCGCTGACGTTCG
ACCCATTCAACAAGCTTGATCGGCAGATGAATGCCCATCTGCTCCTGTTTGGCCCGACAGGTTCAGGTAA
GTCAGCCACGGCCAACAATTTGCTGATGCAGTTAATCGCCATTTACAGGCCGCGCCTGTTCATCATTGAA
GCCGGTAATAGTTTCGGCCTACTGGGAGATTTTGCCCAAAAGCTTGGGCTGACGGTCAACCGGCTCAAGT
TGGCGCCAGGGTCGGGCGTGAGTCTGGCCCCCTTCACTGATGCCATTCGCCTGGTGTCAACACCTGACAA
AGTCACGATCCTGGATGCCGATGACATTGAAGGATCCGATGAGCATCTGCAAACAATGCCTGAACAGGGC
GAAGAGGAGCGTGATGTTTTGGGCGAAATGGAGATCGTAGCCAGGCTCATGATCACCGGCGGCGAAGAGA
GAGAAGAGGCTCGACTCACTCGCGCAGACCGCAGCGCCATTAGGCACTGCATTCTGACGGCAGCCAGAAC
ATGCTTTGACGCTGAACGAGCAGTCAAGACGGAGGATGTGCGTGATGCGCTGAGTGACGCTGGCAAGGAC
ACCACCCTTCCGGAAAAGCGCCGAGAACGCATGTTTGAGATGGCTGAAGCCATGGACATGTTCTGCATGG
GGGCTGACGGTGAGATGTTCAACCGGGAGGGTACGCCTTGGCCTGAGGCCGACATCACAATCCTGGACTT
GGCCACCTACGCCCGCGAGGGGTATAACGCCCAACTGTCGGTCGCCTACATCTCGCTGATCAACACCGTG
AACAACATTGCAGAACGGGACCAATTCAAGGGGCGTCCGATCGTCAACTTCACTGACGAGGGTCACATCA
TTACGAAAAACCCCCTTCTCTCGCCCTACGTCATCAAGATCACCAAGATGTGGCGAAAACTCGGGGCCTG
GTTCTGGCTTGCCACTCAGAACATCGACGACCTTCCGTCAGCAGCAGCACCGATGCTTAACATGATCGAG
TGGTGGATCTGCCTGAACATGCCACCGGATGAAGTGGAGAAAATCACCACGTTCCGTAAGCTGACGCCCG
CGCAAAAGTCACTGATGCTGTCAGCCCGTAAAGAGAGCGGAAAGTATACTGAAGGGGTTGTGCTTTCCAA
ATCGATGGAGGTTTTGTTTCGAGCCGTGCCCCCAAGCCTGCTCCTGGCATTGGCCATGACTGAGCCGGAA
GAAAAAAAACAGCGGTACGATCTAATGCAGTCGTTAGGGGTAGACGAGCTGGGAGCCGCAATAGCGATCG
CACACGACCTCGACCGCATTCGCGGGATTGAACCGACAACCATTACATTCCCCGCTTCGCCCTTGGAGAA
CCTGGCATGA