SecReT4
Protein ID: 28868082
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0861
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]932461..933957 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDQ889A0
KEGG IDpst:PSPTO_0861
PDB IDNA
Domain hit(s) vs Pfam DUF972 [PF06156], Evalue: 9.7e-05, Aligned region: 60..120
Protein Sequence: 498 a.a.     [Download]
>gi|28868082|ref|NP_790701.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MKSNPLLKYLVVPLLLLTVFIGIKMMRGGPEQQADNAPAPKLTAEQAKALGVEGDTPSDTLRTVVAEGRE
LKQQITDVMAQNSAVKQDNEALKQRLANIDQTVEQRLKNAQEQFKLDSQQQQQSVLDGLRKQMDELTRMG
QNGATHPDLPIGLGVQQGDGQQFKSDSSGSDLMWINPQDATALDSNGKPITAGNSVPASAYSFPTAFGES
VDRGQKALTTGAQSVRDDMGGQQQERKKVRRAYTLPQNSTLMGSVAMSALIGRVPVDGTVNDPYPFKVLI
GPDNLTANGIDLPDVAGAVASGTASGDWTLSCVRGQIKSLTFVFNDGTVRTLPAPVQGGNQQNNNQNNQN
NSGDQQPIQGGLGWISDPYGIPCIAGERRSNAQQYIGSQALITAAGAGAASLIKTEGSTSSYVSNASGTL
GSTGLSGNEAMGKILTQGVTDVSSWVNKLYGQAFAAIYVLPGAQVSLHIDQELEIDYELKGRKVKYASGA
NHANANLD
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c933957-932461 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAAGAGTAACCCGCTGCTCAAGTACCTGGTGGTTCCGCTTCTCCTGCTCACGGTGTTCATCGGCATCA
AGATGATGAGAGGTGGACCCGAACAGCAGGCTGACAACGCACCGGCCCCAAAACTCACAGCGGAACAGGC
CAAGGCTCTGGGTGTGGAAGGCGACACGCCGAGCGACACGCTACGCACGGTCGTGGCTGAAGGGCGCGAG
CTCAAGCAGCAGATCACCGATGTGATGGCGCAGAACTCAGCCGTCAAGCAGGACAACGAGGCGCTCAAAC
AACGATTGGCGAACATCGATCAGACGGTAGAGCAGCGTCTGAAGAATGCCCAGGAGCAGTTCAAGCTCGA
CAGTCAGCAGCAACAGCAGAGCGTGCTGGATGGCTTGCGCAAACAGATGGATGAACTGACCCGGATGGGA
CAAAACGGCGCTACGCACCCGGATCTACCGATTGGCCTGGGCGTTCAGCAGGGAGATGGTCAACAGTTCA
AGTCCGACTCAAGCGGTTCGGACCTCATGTGGATCAATCCACAGGACGCGACGGCCCTAGACAGTAACGG
TAAACCGATCACTGCTGGCAATAGCGTCCCCGCGAGCGCCTACAGCTTTCCTACAGCCTTTGGCGAATCG
GTAGACCGAGGACAGAAAGCCCTGACGACAGGCGCTCAGTCTGTCCGCGATGACATGGGTGGCCAGCAAC
AGGAGCGCAAGAAGGTACGTCGTGCCTACACCCTGCCTCAAAACTCGACGTTGATGGGGTCGGTGGCCAT
GTCCGCGTTGATCGGCCGGGTTCCTGTTGATGGGACGGTTAATGACCCCTACCCGTTCAAGGTGCTGATC
GGTCCGGACAACCTGACGGCCAATGGCATCGACCTTCCTGACGTAGCCGGTGCGGTGGCCAGCGGTACAG
CGTCAGGCGACTGGACCCTCTCATGCGTGCGGGGGCAGATCAAAAGCCTGACCTTCGTGTTCAACGATGG
GACTGTCCGTACGTTACCCGCCCCAGTCCAGGGCGGTAATCAGCAGAATAATAACCAGAACAATCAGAAC
AACTCTGGAGACCAGCAACCCATCCAGGGCGGGCTCGGATGGATCAGTGATCCCTACGGCATTCCGTGCA
TCGCCGGCGAGCGACGCAGCAATGCGCAGCAGTACATCGGCTCACAAGCCCTGATTACCGCAGCAGGTGC
TGGAGCAGCCTCGTTGATCAAGACCGAAGGAAGCACCTCCTCTTACGTCTCGAACGCTTCTGGGACGCTG
GGTAGCACCGGTTTGTCTGGTAACGAGGCGATGGGCAAAATTCTCACTCAAGGCGTCACGGACGTGTCCA
GCTGGGTCAACAAACTGTATGGCCAGGCGTTTGCGGCCATCTACGTCTTACCTGGTGCGCAGGTCTCACT
GCACATCGATCAAGAGCTGGAAATTGACTACGAACTCAAAGGCCGCAAGGTCAAATACGCCTCAGGAGCG
AACCATGCCAATGCCAACCTGGATTGA