SecReT4
Protein ID: 28868084
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0863
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]934867..935535 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDQ888Z8
KEGG IDpst:PSPTO_0863
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.4e-89, Aligned region: 8..206
Protein Sequence: 222 a.a.     [Download]
>gi|28868084|ref|NP_790703.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSRYLKLADSQRAHITSLRMAIVLLALLALGLGIGWYRAPQNMTIHVPPDLRSGSTRLWWDIPPQSVYAF
GLYIFQQMNRWPVDGEQDYQTNITRLDAYITPACKQYLQSDFDLRKSSGELRKRVRGVYEIPGRGFGDSP
ELRTVTNSIDDWTVTLDISADEYYGGQLVKRALARYPLHVVRMDVDPETNPFGLAWDCYNGAPQRIEGNV
ETPAAPSKGVFK
 
Nucleotide Sequence: 669 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c935535-934867 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAGCCGTTATTTAAAGCTGGCCGACTCGCAGCGGGCGCACATCACCAGCTTGAGGATGGCCATCGTCC
TGCTGGCGCTCCTGGCCCTGGGGCTGGGTATCGGCTGGTATCGAGCACCGCAGAACATGACCATTCACGT
TCCGCCCGACCTGCGTTCCGGCAGCACACGCCTTTGGTGGGACATCCCTCCTCAGTCGGTGTACGCCTTT
GGCCTGTACATCTTTCAGCAAATGAACCGCTGGCCGGTCGACGGTGAACAGGATTATCAGACGAACATCA
CGCGCCTGGACGCTTACATTACACCGGCTTGCAAGCAATACCTGCAGAGCGATTTTGATCTGCGCAAGTC
CAGCGGTGAGCTGCGCAAGCGTGTCCGCGGTGTCTACGAGATTCCCGGCCGAGGCTTTGGCGACTCGCCT
GAACTGCGGACGGTGACCAACTCCATCGACGACTGGACGGTGACGCTCGACATCTCAGCCGACGAGTATT
ACGGCGGTCAGCTGGTCAAGCGTGCCCTCGCACGATACCCGCTTCACGTTGTACGCATGGACGTCGACCC
TGAAACCAATCCCTTCGGCTTGGCATGGGACTGCTACAACGGCGCGCCACAACGCATCGAGGGCAACGTC
GAAACTCCCGCAGCTCCATCGAAAGGAGTCTTCAAATGA