SecReT4
Protein ID: 28868101
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0881
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]952643..953524 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDQ888Y3
KEGG IDpst:PSPTO_0881
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.2e-16, Aligned region: 80..208
TrwB_AAD_bind [PF10412], Evalue: 2.2e-06, Aligned region: 82..218
Protein Sequence: 293 a.a.     [Download]
>gi|28868101|ref|NP_790720.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MHGRKIPLRYANDPRPIFDWMQVVRKKAVVYIGLDALSDTEVAAAVGNSMFSDLVSVAGHIYKFGVDDGL
PGSVPGTKVPINLHADEFNELMGEEFIPMINKGGGAGMQVTAYTQTMSDIEAKIGNKAKAGQVIGNFNNV
FMLRVRETSTAELLTNQLPKVQVFTSTPASSANDSATGNTAFTSSSHDQVQQVSVPMIEPAHVVGLPKGQ
CFALMEGGNLWKIRMPLPGHDPDEVMPADLQALAESMRQTYQVGKVDDTGWWSAPGYQTLNESLPADLLD
DFKKIAVAPEDAA
 
Nucleotide Sequence: 882 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c953524-952643 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCATGGGAGGAAAATTCCGCTCAGGTACGCCAACGATCCTCGACCGATCTTTGACTGGATGCAGGTGG
TCCGCAAAAAGGCCGTGGTCTATATCGGCCTGGACGCCTTGTCGGACACGGAGGTCGCCGCTGCCGTCGG
CAACTCGATGTTCTCCGACCTGGTCTCGGTCGCTGGCCATATCTACAAGTTCGGCGTCGACGACGGGTTA
CCGGGTAGCGTCCCTGGCACCAAAGTGCCTATCAACCTCCACGCCGATGAGTTCAACGAGCTGATGGGTG
AGGAATTCATTCCGATGATCAACAAGGGTGGCGGTGCCGGCATGCAGGTGACTGCCTACACCCAGACCAT
GAGCGATATCGAGGCGAAGATCGGTAACAAAGCGAAGGCTGGCCAGGTGATCGGTAACTTCAACAACGTG
TTCATGCTGCGCGTCCGTGAAACATCCACCGCCGAGCTGCTCACAAACCAGTTACCTAAGGTTCAGGTTT
TCACGTCCACACCGGCCAGCTCGGCTAATGACAGTGCAACGGGCAACACCGCGTTCACGTCCTCCAGTCA
TGACCAGGTGCAGCAGGTCAGCGTGCCCATGATTGAGCCCGCGCATGTCGTGGGCCTGCCCAAGGGCCAA
TGCTTTGCGCTCATGGAAGGCGGCAATCTGTGGAAAATCAGAATGCCTTTGCCTGGACATGATCCTGATG
AGGTGATGCCGGCAGATCTGCAGGCCCTGGCGGAAAGCATGCGTCAGACCTATCAGGTGGGCAAGGTCGA
CGACACGGGTTGGTGGTCCGCGCCTGGTTATCAGACGCTCAACGAGTCCCTGCCTGCAGATCTGCTCGAC
GACTTCAAAAAAATCGCTGTTGCACCTGAGGATGCGGCATGA