SecReT4
Protein ID: 29171538
T4SS name [ID]Tra_I [174]
Gene symboltraY-2
Locus tagPSPTOA0064
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000A [GenBank: NC_004633] [Browse all T4SS(s) in this replicon]
Location [Strand]63781..65925 [+]
ProducttraY protein
Component typeTraY_I
UniProt IDQ88BL1
KEGG IDpst:PSPTOA0064
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 714 a.a.     [Download]
>gi|29171538|ref|NP_808722.1| traY protein [Pseudomonas syringae pv. tomato str. DC3000]
MNLIKRFWWMGLLLVFSVPVLADNVDYQTIAAASQKPNDLSRQAMVMIMGQVAVDPFAPSQPTLIGSLFA
IINGVLAVMALFWFLTITLKTIVKAGHQGQFFAGGRSALYPIMTFAGFIMILPTQSGWSLAQLVMVWACS
TMGVGSANLLTDKAVDMMDSGYSMVTQPTAPSTRSAARGIFEMNLCKYAINRELESLYADGVANTPLITT
KGGNGQYDTGNGSAVCGSAKTPNTGRTGTWNLLFDSDVDTSGVITAQHQALDTMQSTLDQAAQAFVDTYL
SKRDQDTGSFQDAETQIQNAAAAYENTVNLALNKIDFKDTLQSQLSSQIKSSGWVALGSWYHTFATANNK
TNDVASSTPVVTGMSNLGEHGTGDLYNQVFAAYKSQVQNSTYTAPLGTQTTKDDGAAATANDPNAVFVGI
FKSPMQKLTSLFATGKIGTDASFSNQVNPLIKMQTIGDYTLGTVETLMVAYAGTWAAASSASNSPLGWGA
KIFSVDVGAVVKDVLGALAPMFYFVMFALLAIGFSLAVFLPAVPFLFWMVGIFNWVVSVLVGCAAGSMWA
ATHLGAEEDKGSRSTYGYIFLIDMMLRPSLMVLGFFFASVAVIGGGTILNLLFASALANANADSIVGLFK
MIGWLMIYARIATFGVTRLFGLQASLADYVISFLGGREGANLMGGMVDNMKGMFGAAGSGAQRTPGVKMQ
PRKPGAGGNGDGIQ
 
Nucleotide Sequence: 2145 bp     [Download]
>gi|29171478|ref|NC_004633.1|:63781-65925 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000A, complete sequence
ATGAACCTCATTAAACGCTTCTGGTGGATGGGTCTTCTGCTGGTCTTCTCCGTGCCGGTACTGGCCGATA
ACGTGGATTACCAGACGATCGCGGCAGCCTCCCAAAAGCCCAATGACCTCTCGCGCCAGGCGATGGTCAT
GATCATGGGCCAAGTAGCAGTCGATCCATTTGCACCATCACAGCCAACCTTGATTGGCTCACTGTTCGCC
ATTATCAATGGCGTTCTGGCCGTGATGGCCCTGTTCTGGTTTCTGACCATCACCCTGAAAACCATTGTGA
AGGCTGGGCATCAGGGACAGTTTTTCGCAGGCGGTCGATCTGCGTTGTACCCGATCATGACGTTTGCCGG
TTTCATCATGATCTTGCCCACCCAATCAGGTTGGTCACTGGCCCAGCTCGTCATGGTATGGGCCTGCTCC
ACCATGGGGGTTGGCAGTGCCAATCTGCTGACTGATAAAGCTGTGGACATGATGGACAGCGGCTACTCGA
TGGTGACGCAACCCACGGCTCCTTCAACCCGAAGCGCGGCACGGGGCATCTTTGAAATGAACTTGTGCAA
GTACGCGATCAACCGTGAGCTGGAGTCGCTGTATGCGGATGGTGTGGCCAATACCCCGTTGATTACCACC
AAGGGGGGCAACGGCCAATACGACACTGGCAACGGCAGCGCGGTGTGTGGTTCTGCCAAAACACCCAATA
CGGGCCGCACCGGAACCTGGAACCTGCTGTTTGACAGTGACGTGGACACGAGTGGGGTGATCACGGCGCA
GCACCAAGCGCTAGACACCATGCAAAGCACCCTGGATCAAGCGGCACAGGCGTTCGTAGACACCTACCTG
AGCAAGCGCGACCAGGATACGGGGAGCTTCCAGGACGCCGAGACGCAGATCCAGAACGCAGCCGCCGCCT
ATGAAAACACGGTGAACCTGGCCCTCAACAAGATAGATTTCAAGGACACACTGCAAAGCCAGTTGTCGAG
CCAGATCAAAAGCAGTGGTTGGGTGGCCCTGGGCAGTTGGTATCACACCTTCGCCACAGCTAATAACAAG
ACCAACGACGTGGCCAGCTCGACCCCGGTTGTCACGGGGATGAGTAATCTGGGCGAGCACGGCACCGGCG
ACTTGTATAACCAGGTGTTCGCAGCCTACAAATCGCAGGTGCAGAACAGTACCTACACCGCGCCGCTGGG
GACGCAGACGACCAAGGATGACGGGGCGGCAGCGACGGCGAATGACCCGAATGCAGTGTTTGTTGGCATT
TTTAAGTCGCCTATGCAGAAGTTAACCTCGTTATTTGCAACTGGGAAAATTGGTACTGATGCCAGCTTTT
CCAACCAGGTGAACCCGCTTATCAAAATGCAAACCATTGGTGACTACACGCTGGGAACTGTTGAAACCCT
GATGGTGGCCTATGCCGGGACGTGGGCAGCTGCCTCATCGGCCAGTAATTCGCCGTTGGGCTGGGGTGCC
AAGATATTTTCGGTGGATGTCGGGGCGGTGGTGAAAGATGTGCTGGGTGCGCTGGCCCCGATGTTCTATT
TCGTCATGTTCGCCCTGCTGGCCATCGGTTTTTCGCTGGCCGTATTTCTGCCTGCTGTGCCCTTTCTGTT
CTGGATGGTGGGCATATTCAACTGGGTCGTCAGTGTGCTGGTGGGCTGTGCGGCGGGCTCAATGTGGGCT
GCCACGCACCTGGGGGCCGAAGAGGACAAGGGGAGTCGCAGTACCTACGGTTATATCTTTCTGATCGACA
TGATGCTGCGGCCTTCGTTGATGGTACTGGGGTTCTTTTTTGCGTCGGTGGCCGTAATCGGTGGGGGAAC
GATCCTGAATCTGTTATTCGCCTCGGCGCTGGCCAATGCCAACGCGGACTCGATCGTGGGATTGTTCAAG
ATGATCGGATGGCTGATGATCTATGCCCGCATTGCGACCTTTGGTGTGACTCGACTCTTTGGCCTGCAGG
CGTCCTTGGCGGACTACGTGATCTCGTTCCTGGGCGGTCGAGAAGGCGCCAACCTGATGGGCGGCATGGT
CGATAACATGAAAGGCATGTTTGGTGCTGCTGGCTCTGGGGCACAACGTACCCCTGGCGTTAAAATGCAA
CCTAGGAAGCCTGGCGCAGGGGGCAATGGGGATGGAATCCAGTAG