SecReT4
Protein ID: 298206446
T4SS name [ID]Tra_F [530]
Gene symboltraE
Locus tagETEC1392/75_p1018_030
StrainEscherichia coli ETEC 1392/75 plasmid p1081 (NC_014232)
Repliconplasmid p1081 [GenBank: NC_014232] [Browse all T4SS(s) in this replicon]
Location [Strand]15119..15685 [+]
Productputative conjugal transfer protein TraE
Component typeTraE_F
UniProt IDD7GK60
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 3.2e-70, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|298206446|ref|YP_003717548.1| putative conjugal transfer protein TraE [Escherichia coli ETEC 1392/75]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNEQRTAVTPMGFNVPFAVSQNSADASYL
QQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFYQTSVRVWPQYG
RVEIRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|298206425|ref|NC_014232.1|:15119-15685 Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAATCTCATTCAGGGGGTGAATAACTACCGCCTTCAGAATGAGCAACGCAC
TGCCGTGACCCCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGACGCCTCTTATTTG
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTCTCACCGGAAATCGTCGATGCCTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGTGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
ACTCATTAAAAAAGATAACGTGAATTCTGCTTTTTACCAGACCAGTGTCCGTGTCTGGCCTCAGTATGGT
CGTGTGGAAATCCGTGGAATTCGGAAAACATGGATTGGTAACTCCGAACCTTTTACTGATATCAAACATT
ACATTCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA