SecReT4
Protein ID: 298206452
T4SS name [ID]Tra_F [530]
Gene symboltraG
Locus tagETEC1392/75_p1018_036
StrainEscherichia coli ETEC 1392/75 plasmid p1081 (NC_014232)
Repliconplasmid p1081 [GenBank: NC_014232] [Browse all T4SS(s) in this replicon]
Location [Strand]18889..21705 [+]
Productputative conjugal transfer protein TraG
Component typeTraG_F
UniProt IDD7GK66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.3e-125, Aligned region: 3..450
Protein Sequence: 938 a.a.     [Download]
>gi|298206452|ref|YP_003717554.1| putative conjugal transfer protein TraG [Escherichia coli ETEC 1392/75]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVQVHRVDNVPVGLAMPLSLTTRIGHAMVVSYEMIFTQPDSVTYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYTLEDLMASADPYTLIFSRPSPLRGVYDNNNNFITC
KDASVTLKDRLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASQIMRQNVTINA
LKEGITSNAARNGDTASLVNLATTSSMEKQRLAHVSIGHVTMRNLPMVQTILTGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQTWPLLYAILNSAMTFYAKMNGAPVVLSELSQIQLKYSDLASTAGYLSAMIPP
LSWMMVKGLGAGFSSVYSHFASSSISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNIAESALHGFSSSIASAWNTLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATRELASRSTNASLGLYGDAYAK
GHLGISVLGNGGGVGLQAGAKASIDGSDLDSHEASSGSRASHDARHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSRMDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIAGHQGH
QAIIDQRTQDSNIRNDVKYQVDNMVTEYKGNIGDTQNSIRGEENIVRGQYSELQNHHKTEALTQNNKYNE
EKLVQERIPGADSPKDLLEKAKSYQHKE
 
Nucleotide Sequence: 2817 bp     [Download]
>gi|298206425|ref|NC_014232.1|:18889-21705 Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence
GTGAATGAAGTCTATGTGATTGCCGGTGGTGAGTGGTTACGCAATAACCTGAACGCCATTGCCGCCTTTA
TGGGAACCCGGACGTGGGATTCCATCGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTGAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGTACATCGGTGCAGATTATTGATAACAGTGACCTGGTCCAGGTTCACCGGGTGGATAATG
TTCCGGTCGGTCTGGCGATGCCACTTTCTCTTACGACCCGTATCGGGCATGCGATGGTGGTCAGCTACGA
GATGATATTCACCCAACCGGACAGCGTCACCTACAGCAAGACAGGCATGCTGTTCGGGGCGAATCTGATT
GTGAAAAGCACCGATTTCCTGTCCCGGAATCCGGAAATCATCAATCTGTTCCAGGACTACGTCCAGAACT
GCGTGCTGGGTGATATTTACCTGAATCATAAATACACGCTGGAAGATCTGATGGCCTCCGCTGACCCCTA
CACGCTGATTTTTTCCCGACCCAGCCCGCTACGGGGCGTTTATGACAACAATAATAATTTCATAACCTGT
AAGGATGCGTCGGTCACGCTGAAAGACAGGCTGAATCTCGATACAAAGACGGGAGGCAAGACCTGGCATT
ATTATGTGCAGCAGATATTTGGCGGCAGACCGGACCCGGACCTGTTATTCAGACAACTGGTCAGTGACAG
TTACAGTTATTTCTACGGCTCCAGTCAGTCTGCCAGCCAGATTATGCGCCAGAACGTCACAATAAATGCC
CTGAAAGAGGGTATCACCAGTAATGCCGCCCGTAATGGTGACACCGCCAGCCTGGTGAATCTGGCCACCA
CGTCATCGATGGAGAAGCAACGTCTGGCGCATGTCTCTATCGGTCATGTGACAATGCGAAACCTGCCAAT
GGTACAGACTATCCTGACGGGAATTGCCATTGGTATTTTCCCGCTTCTGGTACTGGCAGCTGTCTTCAAC
AAACTGACACTGTCCGTCCTGAAAGGCTATGTGTTTGCCCTGATGTGGCTGCAGACCTGGCCGTTGTTGT
ATGCCATTCTGAACAGTGCCATGACATTCTATGCGAAGATGAATGGTGCGCCGGTCGTGCTGTCTGAACT
CTCTCAGATACAGCTGAAATACTCTGACCTGGCCTCTACTGCCGGGTATCTTTCAGCCATGATCCCCCCG
TTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGTTTTTCCAGCGTGTACAGCCACTTCGCCTCTTCCT
CTATCAGTCCGACGGCCAGTGCAGCAGGCAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACTGCCACACAGACTCGTGACGGTAATATGGTGATGGATGCAAGCGGAGCGATGTCCC
GGTTACCGGTTGGTATCAATGCAACGCGTCAGATTGCAGCGGCACAACAGGAAATGGCCCGGGAGGCGTC
GAACATAGCAGAAAGCGCCCTGCATGGGTTCAGCAGCAGTATTGCCAGTGCCTGGAACACGCTCAGTCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACCGGTGGCGCTGACAGCACCATGAGTGCACAGGATT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACGAGAGAACTGGCCTCGAGAAGTACAAATGCGTCGCTTGGCCTTTACGGTGATGCTTATGCTAAA
GGACATTTAGGCATAAGTGTATTGGGTAACGGTGGAGGGGTTGGTCTCCAGGCCGGAGCTAAGGCAAGCA
TTGATGGCAGTGATCTTGACTCACATGAAGCCAGTAGTGGTTCACGGGCCAGCCATGATGCTCGTCATGA
TATCGATGCCAGAGCTACACAAGACTTTAAAGAGGCCAGCGATTACTTTACCAGCCGCAAAGTCAGTGAA
TCCGGCAGCCATACTGACAATAATGCCGATTCCCGTATGGACCAGCTGTCTGCAGCCCTGAACTCAGCGA
AACAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGATCTGTCGCAACAGTTTGCACAGTATGTGATGAAACACGCA
CCGCAGGATGCCGAAGCTATTCTGACAAACACCAGTTCACCGGAGATTGCAGAACGCCGCCGGGCGATGG
CGTGGTCTTTTGTGCAGGAACAGGTGCAGCCTGGTGTTGATAATGCCTGGCGTGAATCCCGTGGCGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGCCAGGATATTATTGCTGGCCATCAGGGACAT
CAGGCCATTATTGATCAAAGAACGCAGGACAGTAATATCCGGAATGATGTAAAATATCAGGTTGATAATA
TGGTCACAGAATATAAAGGGAATATAGGTGATACTCAGAACAGTATCCGTGGCGAGGAAAATATTGTAAG
AGGGCAGTATTCTGAACTACAAAATCATCATAAAACAGAAGCATTAACTCAGAATAATAAATATAATGAA
GAAAAGCTGGTTCAGGAAAGAATACCTGGTGCTGATAGTCCGAAAGATCTTTTAGAGAAAGCAAAGAGTT
ACCAGCATAAAGAATAA