SecReT4
Protein ID: 298206456
T4SS name [ID]Tra_F [530]
Gene symboltraD
Locus tagETEC1392/75_p1018_040
StrainEscherichia coli ETEC 1392/75 plasmid p1081 (NC_014232)
Repliconplasmid p1081 [GenBank: NC_014232] [Browse all T4SS(s) in this replicon]
Location [Strand]24006..26204 [+]
Productputative conjugative transfer TraD protein
Component typeTraD_F
UniProt IDD7GK70
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 3e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 5.5e-34, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1.1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2.3e-10, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 1e-07, Aligned region: 382..476
Protein Sequence: 732 a.a.     [Download]
>gi|298206456|ref|YP_003717558.1| putative conjugative transfer TraD protein [Escherichia coli ETEC 1392/75]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQRPPGISESGEVVDMAAYEAWQQEN
HPGIQQQMQRREEVNINVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2199 bp     [Download]
>gi|298206425|ref|NC_014232.1|:24006-26204 Escherichia coli ETEC 1392/75 plasmid p1081, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATACTCGTTGGTCTGGTTTTATGGGT
AAAAATAAGCTGGCAGACGTTTGTGAACGGCTGTATTTACTGGTGGTGTACCACGCTGGAAGGCATGCGG
GATTTAATCAAGTCCCAGCCAGTATATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCGGCTC
AGGTACTGCATGATAAATACATGATCTGGTGCGGTGAGCAGCTATGGTCTGCATTCGTTCTGGCGTCTGT
CGTGGCCCTGGTTATTTGCCTGATCACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACAGACAATCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAAGGACTCCGATATCCGGATTGGCGACCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAGGTTATCCGTCGTCTGGCCAACTACGCCCGT
CAGCGCGGTGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCCCGCTGTGCCGCATGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCAAATACTCTGATCCCTATGGGAACAAAAGAAGACCCGTTCTGGCAGGGT
TCAGGGCGTACCATTTTTGCGGAAGCGGCGTACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATCGAAAAACTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATTGAGAAAACGGCGATTTCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGAACCCTTTACCATCCGTGACTGGATGCGGGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATTTCGTCGAACGCCGACACCCATGCCTCCCTGAAACCGGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAATCGTAACCGTCGTGTG
TGGTTTTTCTGTGACGAGTTACCCACGTTACACAAACTGCCGGACCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCGGCCACGCTGTTTGACGTCATGAACACTCGTGCTTTTTTCCGTTCCCCGAGCCATAAGATTGCA
GAGTTCGCGGCCGGTGAGATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ATCCGGTACGTGACGGGGTATCTACCGGTAAGGATATGGAGCGCCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGTTATGTCACCCTGCCCGGACCGTATCCGGCAGTAAAACTCTCCCTG
AAATATCAGACACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCTGCAAGGGAAGCAGAAGGTCGCCAGATGGCCAGCCTCTTCGAACCGGAGGT
TGCCTCCGGAGAAGACGTGACTCAGGCTGAACAGCCACAACAGCCACAACAGCCACAACAGCCACAACAG
CCACAACAGCCACAACAGCCACAACAGCCAGTGTCTTCTGTCATCAATGATAAGAAGTCAGATGCAGGTG
TGAGTGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAAACCGGAAGAAGAGATGGAACAGCAACG
GCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCCGCTTATGAGGCATGGCAACAGGAAAAT
CATCCGGGCATCCAGCAGCAGATGCAGCGTCGTGAAGAGGTGAACATTAATGTGCACCGGGAGCGCGGGG
AGGATGTTGAGCCGGGAGATGATTTCTGA