SecReT4
Protein ID: 300837049
T4SS name [ID]Tra_F [107]
Gene symboltraA
Locus tagpKP048_p110
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]95852..96220 [+]
Productconjugal transfer pilin subunit TraA
Component typeTraA_F
UniProt IDD4HQJ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.2e-33, Aligned region: 1..120
Protein Sequence: 122 a.a.     [Download]
>gi|300837049|ref|YP_003754103.1| conjugal transfer pilin subunit TraA [Klebsiella pneumoniae]
MNAVLSVQGSAVSEKTKPSFMSRVFNKKKALKVAKVALPVAAVAAFFPDAAMATTTATDLMKSGDATVKG
TFGKQSSVVKWVVLAEVVAGGIMYMMTKNVKFLFGFAIISTFITIGMSVAGY
 
Nucleotide Sequence: 369 bp     [Download]
>gi|300836939|ref|NC_014312.1|:95852-96220 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGAATGCTGTATTAAGTGTTCAGGGCTCTGCTGTCTCTGAAAAAACCAAACCGTCTTTTATGTCCCGCG
TTTTCAATAAAAAGAAAGCCCTGAAAGTCGCTAAAGTTGCGCTGCCGGTTGCTGCTGTGGCGGCGTTCTT
CCCGGATGCTGCGATGGCCACCACCACGGCAACCGACCTGATGAAGTCCGGGGATGCGACCGTTAAAGGC
ACGTTTGGTAAGCAGTCCAGCGTCGTCAAATGGGTGGTTCTGGCAGAAGTTGTCGCCGGCGGCATCATGT
ACATGATGACCAAAAACGTGAAGTTCCTGTTTGGCTTCGCGATTATTTCCACCTTTATCACCATCGGTAT
GTCGGTCGCCGGTTACTGA