SecReT4
Protein ID: 300837053
T4SS name [ID]Tra_F [107]
Gene symboltraB
Locus tagpKP048_p114
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]97852..99276 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDD8L2N6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-38, Aligned region: 209..405
Protein Sequence: 474 a.a.     [Download]
>gi|300837053|ref|YP_003754107.1| conjugal transfer pilus assembly protein TraB [Klebsiella pneumoniae]
MANFNTLIKRKQYIWLGLILAGGAAAVGGGLYLSDLNMSSDEEAPAQGEPAPDMTGVVDSSFNSKVEQHA
TTEMQATAADLNKRFDSLQGEVELLSKARTADQIRIDKLSSDNEAMQNQLKSLGVKPAVSGGEPAPTPPS
PPPGPEGEPQPASYPPQTGAAVPPPTAFYPGNGMTPPPQVSYQSVPVPNQIQRKTFSYDKGKKTKSLPYI
PSGSFAKSMLIEGADANASVTGNESTVPMQLRITGRVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTR
NISCIKGDKTIDQPINGHVSFMGKNGVKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAS
VGAGDVLKMGVGGGASKAAQTLSEYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTIEELEAEKNGQQQ
AQNQEAEPAQQADAHHQSGGGMNGFNTDEMLKKLGKLDPREFSPGAAPQGENNG
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|300836939|ref|NC_014312.1|:97852-99276 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGGCCAACTTCAACACGCTGATCAAACGTAAGCAATATATCTGGCTGGGACTCATTCTGGCGGGCGGCG
CGGCAGCAGTCGGAGGCGGGCTGTATCTGTCAGATCTGAACATGAGCTCTGATGAGGAAGCCCCGGCTCA
GGGCGAACCCGCACCGGATATGACCGGGGTGGTCGACAGCAGCTTCAACAGTAAGGTGGAGCAGCACGCG
ACAACAGAAATGCAGGCGACTGCCGCTGATCTCAACAAGCGTTTTGACTCCCTGCAGGGGGAAGTGGAAC
TACTGAGTAAGGCGCGAACCGCTGACCAGATACGTATCGACAAACTCAGCAGTGACAATGAAGCCATGCA
GAATCAGCTGAAGTCGCTGGGCGTGAAACCGGCTGTCTCTGGTGGCGAGCCCGCGCCGACTCCTCCGTCA
CCGCCACCCGGTCCGGAAGGGGAGCCGCAGCCAGCCAGTTATCCGCCGCAAACCGGCGCCGCGGTACCGC
CTCCGACGGCATTCTATCCGGGGAATGGTATGACACCGCCGCCGCAGGTCAGCTACCAGTCTGTACCGGT
ACCAAACCAGATACAGCGTAAAACGTTCAGTTACGACAAAGGAAAAAAAACGAAGTCATTGCCGTACATT
CCGTCGGGGAGCTTTGCAAAAAGCATGCTTATCGAGGGGGCAGATGCCAACGCGTCTGTTACCGGGAATG
AATCAACTGTACCGATGCAGTTGCGTATCACCGGTCGCGTGGAAATGCCAAACAGCAAAACCTACGACCT
GACAGGGTGTTTTGTGGGCCTTGAAGCCTGGGGCGATGTCTCCAGCGAACGCGCCATTGTCCGTACCCGC
AATATCAGCTGTATCAAAGGTGATAAAACCATCGATCAGCCCATTAACGGCCACGTTTCCTTTATGGGGA
AAAACGGGGTTAAGGGAGAGGTGGTGATGCGTAACGGAAAAATCCTCGGCTGGGCATGGGGGGCCGGTTT
TGTTGACGGGATTGGTCAGGGCATGGAACGGGCTTCACAGCCGGCTGTTGGCCTGGGGGCAACCGCATCT
GTTGGCGCCGGTGACGTTCTGAAAATGGGGGTCGGCGGTGGTGCATCTAAAGCTGCGCAGACGCTGAGCG
AGTACTACATCAAAAGGGCCGAGCAGTATCACCCGGTCATTCCGATTGGTGCCGGCAACGAAGTGACCGT
CGTGTTCCAGGATGGATTCCAGCTGAAAACGATTGAAGAACTGGAAGCGGAAAAGAACGGGCAACAGCAG
GCTCAGAATCAGGAGGCGGAGCCGGCACAGCAGGCTGATGCACATCATCAGTCAGGCGGCGGTATGAACG
GATTCAATACTGACGAGATGCTGAAGAAGCTGGGCAAACTTGATCCGCGTGAGTTCTCTCCGGGCGCAGC
GCCGCAGGGGGAAAATAATGGCTAG