SecReT4
Protein ID: 300837065
T4SS name [ID]Tra_F [107]
Gene symboltraN
Locus tagpKP048_p126
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]107898..109853 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDD8L2P8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.8e-71, Aligned region: 354..600
Protein Sequence: 651 a.a.     [Download]
>gi|300837065|ref|YP_003754119.1| conjugal transfer mating pair stabilization protein TraN [Klebsiella pneumoniae]
MKTVISVLTAHFFVLSAFIWLASPACADSGSDYKAGSDFAKQVQGNGLNSLKNFSGEQNLPGYTDNPDQT
KYYGGVTASGDSSLKSDSALEFSQGDTGKTITESFTNRPPDQISQDAPFIQAAKDTESRADSIVGDTGQS
CTAQVVNRSEFTNHTCERDLQVENFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTNG
RLLNASVDGEPLVIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVISWPRSESTCSGGQNTHCTKY
TYDGKGKIHQSFGVDKAVIAGQNFSVSKTSRTVSSASQKPVQVTVTLVMEETETVYAPEVVWVESCPFSK
DEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQPADNGSCESLMKNTACTLSSRQCAFSSE
EGTCLHEYATYSCETRTSGKQMICGGDVFCLDGECDKATSGKSNDFGQAVSELAALAAAGKDVAALNGVD
VRAFTGKAKFCKKFAAGFSNCCKDSGWGQDVGLASCSSEEKALAKAKKDKLTVSIGEFCSKKVLGICLEK
KRSYCQFDSKLAQIVQQQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNKLDFTNFMDDLMKNQKIPEN
DVLTNKTRERIKEIMSQQSAQ
 
Nucleotide Sequence: 1956 bp     [Download]
>gi|300836939|ref|NC_014312.1|:107898-109853 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGAAGACGGTTATTTCCGTGCTGACCGCGCATTTTTTTGTCCTGAGCGCCTTCATCTGGCTGGCATCCC
CCGCCTGCGCTGACAGTGGAAGTGACTATAAAGCCGGTTCGGATTTTGCGAAACAGGTGCAGGGCAATGG
TCTGAACTCACTAAAAAATTTCAGTGGTGAGCAAAACCTGCCGGGGTATACCGACAACCCGGATCAGACA
AAATACTACGGCGGCGTCACTGCCAGCGGAGACAGCTCTCTGAAAAGCGATTCAGCCCTGGAGTTCAGCC
AGGGAGATACCGGCAAAACGATTACGGAGTCGTTCACGAACCGGCCACCGGATCAGATATCTCAGGATGC
GCCGTTTATTCAGGCCGCAAAGGATACAGAATCCCGTGCCGACAGCATTGTCGGTGATACCGGACAGTCC
TGTACCGCCCAGGTTGTGAACCGCAGCGAGTTCACAAACCATACCTGCGAACGTGATCTGCAGGTGGAAA
ATTTTTGCACACGGGAAGCGACCCTGAAGGATAACGCCACCACACAGAAAGTTAACCGAACCTATCAGCA
GGTGGTGACGCTGAATTATGCCCGGAGTACCCGGCAATGGAGTGGCAACCTGACGATCCCGACCAACGGT
CGTCTGCTGAATGCCTCGGTGGATGGTGAGCCTCTGGTGATCCCCTGGATTGAAGAATGCGATTCCGAAG
GGAAGGTGCGGGATAGCTGCAAGAGTGCAGTGAGTGAAAGCCTGACCCTCTTTGAACGAACGTTCCCCAT
TGATGTGATCAGCTGGCCACGTTCAGAATCGACGTGTTCAGGCGGTCAGAACACGCATTGTACGAAATAT
ACCTATGACGGGAAGGGGAAGATTCATCAGTCGTTTGGTGTGGACAAAGCGGTCATTGCTGGGCAGAACT
TTTCAGTAAGCAAAACATCACGGACCGTATCATCGGCCAGCCAGAAACCCGTACAGGTCACGGTCACCCT
GGTGATGGAAGAAACCGAAACCGTCTATGCACCTGAAGTCGTCTGGGTTGAAAGCTGTCCGTTCAGTAAG
GATGAAGGGAAAAAAACGGGCGAGGAATGTATCAGTCCGGGAGGAACGCGAACCATCACCCTCGGAGGCA
GGGATTACTCGTTCACGGAGGCCTGCTGGAAATATAAGGATACCTGGCTCACGCAGCCGGCGGACAACGG
CTCCTGTGAAAGCCTGATGAAAAATACGGCCTGTACTCTGTCATCCCGCCAGTGCGCCTTCTCCAGCGAG
GAAGGCACGTGCCTGCATGAATATGCAACGTATTCCTGCGAAACCAGGACGAGTGGCAAGCAAATGATCT
GCGGCGGTGATGTCTTCTGCCTTGATGGTGAATGTGACAAAGCCACGTCCGGGAAGAGCAACGACTTTGG
GCAGGCGGTGTCTGAGCTGGCGGCACTGGCTGCCGCGGGGAAGGACGTCGCGGCACTGAACGGGGTGGAT
GTCCGGGCATTCACCGGAAAAGCGAAGTTCTGTAAGAAGTTTGCTGCCGGCTTCAGTAACTGCTGCAAAG
ACAGTGGCTGGGGCCAGGATGTGGGGCTGGCAAGCTGCAGCAGCGAGGAAAAGGCGCTGGCCAAAGCGAA
AAAAGACAAGCTGACGGTCAGTATAGGGGAATTCTGCTCTAAAAAGGTTCTGGGGATTTGCCTGGAGAAA
AAAAGGAGCTATTGCCAGTTCGACTCAAAACTGGCGCAGATCGTTCAGCAGCAGGGAAGAAACGGTCAGC
TGCATATCGGTTTTGGCGGCGCCAGCAGTCCTGACTGTCGGGGCATTACCGTCGCGGAACTCCAGGGGAT
TGATTTTAACAAGCTGGATTTCACCAACTTTATGGACGACCTGATGAAAAATCAAAAAATACCGGAAAAC
GATGTGCTCACCAATAAGACCAGAGAACGAATTAAGGAAATCATGAGTCAGCAATCCGCGCAATAA