SecReT4
Protein ID: 304311435
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18030
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2255726..2257051 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDE1VKP4
KEGG IDgpb:HDN1F_35150, gpb:HDN1F_18030
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3e-31, Aligned region: 36..423
Protein Sequence: 441 a.a.     [Download]
>gi|304311435|ref|YP_003811033.1| unnamed protein product [gamma proteobacterium HdN1]
MLSGSQAMVAAPVSQTVPVSGANIVDLIKVGLTGISGGCLNYCITGICVHYNGLKVIISPRIAHNTSEFT
VSSFRAQGQQPWIEWKRVFGNIQASLANGIFGTLLGTGQIGGYGTYTEEHKENDRQLPFKEVDINGHPLA
LLPMLLGSGGMTAGGATQPPTEADFTEAQTAAGSMVDASDFAAMFMNSEILDVFSYMNTMNQIGTMASEM
SEVMDYLSSMQDLASGMGGSGSYDLLCESTVTPFIPFYLSAIDTLTWRLPWPDVLTHSVDLAYGMTPFLP
NRKVIGTPDAMPTLTNGVWAGLYPRIGFVNQEHDGKVGAVASQRALDLVLAEDGNDHFGHVTLFNPGFAN
QRDWHIIPYEFHASGVKGGVWQQVHPIPKAECRPSLYRDRELSDTAEDHSAPVVLGGDQNYIWAFWRRYE
CCMNRKGVFIGAIPTPDICLF
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2257051-2255726 Gamma proteobacterium HdN1 chromosome, complete genome
GTGCTGTCAGGCAGTCAGGCCATGGTCGCCGCCCCCGTTTCACAAACGGTGCCCGTCAGTGGCGCAAATA
TCGTCGATCTGATTAAAGTCGGGCTCACCGGAATCTCCGGTGGGTGCCTGAACTATTGCATCACCGGTAT
TTGCGTCCACTACAACGGCCTCAAGGTCATCATCAGCCCGCGAATTGCGCATAACACCTCAGAATTTACC
GTGTCCTCCTTTCGGGCGCAGGGCCAGCAGCCGTGGATCGAATGGAAGCGTGTGTTTGGCAATATACAGG
CCAGTTTAGCCAACGGTATTTTCGGTACGCTGCTCGGCACAGGGCAGATTGGTGGATATGGCACCTACAC
CGAAGAGCACAAAGAAAACGACCGCCAATTGCCATTCAAAGAAGTCGATATTAACGGCCATCCGCTGGCG
CTGCTGCCCATGCTATTGGGTTCAGGTGGGATGACCGCAGGTGGAGCCACCCAACCGCCTACAGAGGCTG
ACTTTACCGAAGCACAAACTGCGGCAGGCAGCATGGTAGATGCCTCAGATTTTGCCGCAATGTTCATGAA
CTCCGAAATCCTCGACGTATTTTCGTACATGAATACGATGAACCAAATCGGCACCATGGCGAGTGAAATG
AGCGAGGTGATGGACTATCTGTCGTCCATGCAGGATCTGGCTTCGGGCATGGGGGGGAGTGGCAGTTACG
ACTTGCTCTGCGAGAGTACAGTAACGCCGTTCATTCCGTTCTATTTAAGCGCCATCGACACGCTGACGTG
GCGCCTACCGTGGCCGGATGTACTGACTCATTCGGTGGACTTGGCGTATGGTATGACGCCTTTCTTGCCG
AACCGTAAAGTGATCGGCACCCCTGATGCTATGCCGACACTCACCAACGGCGTGTGGGCAGGGCTTTATC
CGCGCATTGGATTTGTTAACCAAGAACACGATGGCAAAGTGGGCGCGGTGGCGTCCCAGCGTGCCCTTGA
TCTTGTCTTGGCCGAGGACGGAAACGATCATTTTGGCCACGTCACACTTTTTAATCCCGGCTTTGCCAAC
CAGCGCGACTGGCACATCATCCCCTACGAATTTCATGCCAGCGGCGTGAAAGGCGGAGTGTGGCAGCAGG
TGCATCCCATCCCCAAAGCGGAGTGCCGCCCCTCTCTGTACCGTGACCGAGAGCTCAGTGATACCGCAGA
AGATCACAGCGCACCGGTCGTGCTGGGTGGCGACCAAAACTACATCTGGGCGTTTTGGCGGCGGTATGAG
TGCTGCATGAATCGCAAAGGCGTATTTATTGGTGCAATCCCAACGCCCGATATTTGCCTGTTCTAG