SecReT4
Protein ID: 304311437
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18050
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2257570..2260428 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDE1VQK4, E1VKP6
KEGG IDgpb:HDN1F_18050, gpb:HDN1F_35130
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.5e-38, Aligned region: 515..871
TraC_F_IV [PF11130], Evalue: 5.6e-33, Aligned region: 50..319
FtsK_SpoIIIE [PF01580], Evalue: 7.6e-05, Aligned region: 510..544
Protein Sequence: 952 a.a.     [Download]
>gi|304311437|ref|YP_003811035.1| unnamed protein product [gamma proteobacterium HdN1]
MMPSANTVKKSAKPAANWLQRLSGQRPWRGRAPLTEKDYAKLWDGPKHAIPDYLPWVDFDDEKKVFLLND
GVSVGAVFELRQVNVEGKSSEFIGKVQQALKRALAGVPEVYEGNPWIVQIYLQDEPIESLVQEMQRYAKP
AARESQHSKEWFNLLEEHVRQMSREQGIFEDELAGIRWRGLTRRVRLVLYRYTERGEWLTEDNTLKRSNR
SPSRELNQAARVFTRALQGAGVAVKRLEGAAFFEWMGPFCSPNPVHAKDGYEWVRSVKRYPAPGKRTATY
DFGQAVFAEEPRTDEDGRFWFCDQPTRFLSITPLETTPDVGVITAEIKNASGKEVSLWDELPRGSLFTMT
IVIESQLHIKHHLEDIIQSGGRATREAEMATDQAQHALNYLAEGNRIYRVYPGVYLRGDTDAALEDAMLN
TMTILSQAGLSVIPPKWDLAPIDAFLRALPMAYHYTYDRARLKRAWLCDADDLTALLPLYGRSTGTGNPG
FFFFNRVGEPLLVDPFNKRDRTKTAHLLLFGPTGSGKSATANYLLQHIAAIHDPRLFIIEKGNSFGRLGK
HFAGMGKTVNHIRFTPSLNISLPPYAETSRALEQLEFQEEMRKSREKMAANGEVDDAISFQVDAEAIDDG
EDDEDDQRDFLGEMVNLTILMVTGASKREEEHLSQADRALLKECLIEGLLASARRGAPHALPQDVVDVMN
ERLKIPSTDEHQRLRLRDMSTALGKWTSGIHGHYFNRYGESWPEADCTIVDMGILTGNNNDDMLAVALIS
LINTITGLGEKYQHVQGARETIVLIDEGHVITKNPVLAKPLVFGLKTWRKLAIWLWQATQNLADYPDEAE
VMLALAEWWICLTMESEQEIKQIARFKPLTEDERALLVSARKQDGAFTEGVILGSKIKALFRVVMPALPL
VLSMTDVDQKKAIAELARKHGISEIAAAHMMAKKIIQAREQA
 
Nucleotide Sequence: 2859 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2260428-2257570 Gamma proteobacterium HdN1 chromosome, complete genome
ATGATGCCGAGTGCGAACACGGTCAAAAAATCCGCCAAACCCGCCGCCAATTGGCTGCAACGCCTGTCAG
GGCAACGTCCGTGGCGCGGTCGTGCGCCGTTGACCGAGAAAGACTACGCCAAACTTTGGGATGGCCCCAA
ACACGCCATTCCCGATTATTTGCCGTGGGTCGATTTTGACGATGAAAAGAAAGTATTTTTGCTTAACGAC
GGCGTAAGTGTTGGCGCCGTTTTTGAGTTGCGCCAAGTGAATGTTGAAGGGAAATCCTCGGAATTTATTG
GCAAAGTGCAGCAGGCGCTCAAGCGGGCGCTGGCAGGCGTGCCGGAAGTCTACGAAGGCAACCCGTGGAT
TGTGCAAATCTACCTGCAAGACGAACCGATCGAATCGCTGGTGCAGGAGATGCAGCGTTACGCAAAGCCT
GCGGCACGGGAAAGCCAGCACTCCAAAGAATGGTTCAACTTGTTGGAGGAGCATGTTCGCCAGATGTCAC
GCGAGCAGGGGATTTTTGAGGACGAACTGGCGGGGATCCGCTGGCGCGGCCTCACCCGACGGGTGCGCTT
GGTGCTATATCGCTACACCGAGCGCGGCGAGTGGCTGACGGAAGATAATACGCTGAAACGCTCCAATCGC
AGCCCCAGCCGTGAACTCAATCAAGCGGCCCGCGTGTTTACACGAGCGCTACAGGGTGCAGGCGTGGCTG
TAAAGCGTCTGGAGGGCGCCGCATTTTTTGAGTGGATGGGGCCGTTTTGCTCACCTAACCCCGTACACGC
CAAAGATGGTTATGAGTGGGTACGCAGTGTAAAACGCTATCCAGCACCGGGAAAGCGCACCGCCACCTAC
GATTTTGGGCAAGCGGTTTTTGCAGAAGAGCCGCGCACGGATGAGGACGGACGGTTTTGGTTTTGCGACC
AGCCCACACGCTTTCTGTCGATCACCCCACTGGAAACGACACCCGATGTTGGCGTGATTACCGCCGAAAT
TAAAAATGCCAGCGGCAAAGAAGTCTCGTTGTGGGATGAGCTGCCGCGTGGCTCGCTATTCACGATGACC
ATCGTGATCGAATCGCAACTGCACATTAAACATCACCTCGAAGACATCATTCAGTCCGGTGGTCGTGCGA
CGCGAGAGGCGGAAATGGCCACCGACCAAGCCCAGCATGCGCTCAACTATTTGGCCGAAGGCAACCGAAT
TTACCGAGTGTACCCTGGCGTTTATTTACGGGGTGATACCGACGCTGCACTCGAAGATGCCATGTTAAAC
ACCATGACCATCCTGTCGCAGGCGGGCCTGTCGGTCATTCCGCCCAAATGGGATTTAGCACCGATCGACG
CTTTTTTGCGGGCGTTACCGATGGCCTATCACTACACCTACGACCGTGCCCGCCTCAAGCGCGCATGGCT
GTGCGATGCCGATGACCTCACTGCACTCTTGCCGTTATATGGTCGCTCTACCGGCACTGGAAACCCCGGC
TTTTTCTTCTTTAACCGTGTGGGTGAGCCGCTGTTGGTCGATCCTTTTAATAAGCGCGACCGCACGAAAA
CCGCTCACTTACTGCTGTTCGGGCCAACAGGTTCTGGTAAATCTGCGACGGCAAACTACCTGCTACAGCA
TATTGCGGCCATTCATGACCCACGACTGTTCATCATTGAGAAAGGCAACAGTTTTGGGCGTCTAGGCAAG
CATTTTGCCGGCATGGGCAAAACCGTGAACCACATTCGCTTTACTCCCTCGCTCAACATATCGCTGCCGC
CTTATGCAGAAACTTCGCGTGCGCTGGAGCAACTGGAATTTCAGGAGGAGATGCGAAAATCGCGTGAAAA
AATGGCCGCCAATGGTGAGGTGGATGATGCGATTAGCTTTCAGGTAGACGCTGAAGCCATCGACGATGGA
GAAGATGATGAGGACGATCAGCGCGATTTTCTTGGTGAGATGGTCAACCTCACCATTTTAATGGTCACCG
GTGCCAGCAAGCGCGAAGAAGAGCATCTGTCGCAGGCAGATCGTGCGCTGTTAAAAGAATGCCTCATTGA
AGGACTGCTGGCCAGCGCCCGACGCGGGGCGCCTCACGCATTGCCGCAAGACGTGGTTGATGTGATGAAT
GAGCGCCTGAAAATCCCCAGTACCGATGAGCATCAACGGCTGCGTTTACGCGACATGAGTACGGCGCTCG
GCAAGTGGACGTCGGGTATTCATGGCCATTACTTCAACCGTTATGGAGAAAGTTGGCCAGAGGCGGATTG
CACCATCGTGGATATGGGGATTCTTACCGGTAACAACAACGACGACATGCTAGCCGTCGCGCTGATTTCC
CTGATCAACACGATCACAGGGCTGGGGGAGAAATACCAGCATGTGCAAGGGGCACGCGAAACCATCGTGT
TAATCGACGAAGGCCACGTGATCACCAAAAACCCTGTACTCGCCAAACCCTTAGTGTTTGGCCTGAAAAC
ATGGCGGAAGCTGGCGATTTGGTTGTGGCAAGCGACGCAAAACCTCGCCGACTACCCCGATGAGGCCGAG
GTGATGCTCGCGTTGGCCGAGTGGTGGATCTGCCTCACGATGGAATCCGAGCAGGAAATCAAACAAATTG
CGCGATTCAAACCACTGACAGAAGACGAGCGAGCCTTGCTAGTCAGCGCCCGAAAACAGGATGGCGCATT
TACCGAAGGCGTAATTCTGGGCTCAAAAATCAAAGCGCTGTTCCGTGTCGTGATGCCCGCCTTGCCACTC
GTGCTGTCCATGACCGACGTCGATCAGAAGAAAGCGATTGCTGAGCTGGCACGTAAGCACGGCATCTCTG
AAATCGCCGCCGCCCACATGATGGCCAAGAAAATCATCCAAGCACGGGAGCAAGCATAA