SecReT4
Protein ID: 304311438
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18060
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2260425..2260970 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDE1VKP7
KEGG IDgpb:HDN1F_18060, gpb:HDN1F_35120
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 181 a.a.     [Download]
>gi|304311438|ref|YP_003811036.1| unnamed protein product [gamma proteobacterium HdN1]
MRPSSISIAFMLAASLGALSGCANQVLPDTGPDIQEVYQRHVGGMKGEPARPLSDEEKEARRMEKENAKT
ADGALGANRNQYRPTLDGSADLVNYTRDAHNEIEQLFPVLPNPQIVMYVYPHFTARGRPVPGYSTAFKLY
EREEYAMPGEWIADHPSALPPPPAAAATPASGNLQMRGKRK
 
Nucleotide Sequence: 546 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2260970-2260425 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCGGCCTTCCTCAATTTCAATCGCTTTCATGCTTGCCGCGAGCCTCGGCGCCTTAAGCGGCTGCGCCA
ACCAAGTACTGCCCGATACAGGCCCCGATATTCAAGAGGTCTACCAGCGCCACGTGGGCGGAATGAAGGG
CGAACCCGCCCGCCCCTTAAGCGATGAAGAAAAAGAAGCGCGGCGGATGGAAAAGGAGAACGCAAAAACC
GCCGACGGTGCCTTAGGCGCAAACCGTAATCAATATCGGCCAACGCTCGATGGCAGCGCGGATCTGGTGA
ACTATACCCGCGATGCGCATAACGAAATTGAGCAACTCTTTCCCGTATTGCCCAACCCGCAGATCGTCAT
GTACGTCTATCCACATTTTACGGCGCGGGGGCGGCCTGTGCCCGGCTATTCCACCGCTTTCAAGCTGTAT
GAGCGTGAAGAATATGCGATGCCCGGCGAGTGGATTGCCGACCATCCAAGCGCCTTGCCACCGCCTCCAG
CGGCGGCCGCAACGCCCGCCAGTGGAAACCTTCAGATGCGAGGTAAGCGGAAATGA