SecReT4
Protein ID: 304311443
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18110
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2264384..2265028 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDE1VKQ2
KEGG IDgpb:HDN1F_18110, gpb:HDN1F_35080
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.7e-44, Aligned region: 8..198
Protein Sequence: 214 a.a.     [Download]
>gi|304311443|ref|YP_003811041.1| unnamed protein product [gamma proteobacterium HdN1]
MAAYHDLIDEKDRIIRYISRVSIGLLIGLVLAIFGWMRAQHEITVYQPPDIRLHTVSSAGYIPEETVYAF
VPLIMQQLYLWDNGGDQDYENNRYRVRQFLTDKYQRTILDEIETGKLRGTLKGLQRRLQVLPSSVYSDSS
VEVVGNYWRVWIDVKITDSIKNMKVNDGVHRLAVRVVRYDINRDANPWQLAIDGIEQDIPLVSAKTVPLT
PEKN
 
Nucleotide Sequence: 645 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2265028-2264384 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGCAGCGTATCACGATTTAATCGACGAAAAAGACCGGATCATTCGCTACATCAGCCGCGTGTCGATCG
GGCTGTTAATTGGGCTGGTGTTGGCCATTTTTGGCTGGATGCGTGCACAACACGAGATCACCGTGTATCA
GCCCCCTGACATTCGACTGCACACGGTATCCAGTGCGGGGTATATCCCAGAAGAAACCGTGTACGCCTTC
GTCCCGCTGATCATGCAGCAGCTGTATTTGTGGGACAACGGGGGCGATCAAGATTACGAAAACAACCGCT
ACCGAGTGCGCCAGTTTCTAACCGACAAATACCAACGGACGATTCTGGACGAAATCGAAACCGGAAAGCT
GCGTGGAACTCTCAAAGGGTTGCAGCGCAGATTGCAGGTTCTGCCGTCCAGCGTGTACTCGGATTCCTCT
GTAGAGGTTGTGGGAAACTACTGGCGCGTCTGGATCGACGTCAAAATCACCGACTCGATTAAAAACATGA
AGGTGAATGATGGCGTGCACCGCTTGGCCGTGCGAGTGGTGCGTTATGACATTAACCGCGATGCGAATCC
GTGGCAGTTGGCGATCGACGGGATTGAGCAAGACATACCGCTGGTATCGGCAAAAACGGTACCGCTGACG
CCTGAAAAAAATTGA