SecReT4
Protein ID: 304311449
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18170
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2267540..2269669 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDE1VKQ8
KEGG IDgpb:HDN1F_18170, gpb:HDN1F_35020
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.6e-13, Aligned region: 181..238
TrwB_AAD_bind [PF10412], Evalue: 2.6e-13, Aligned region: 512..653
TraG-D_C [PF12696], Evalue: 6.5e-11, Aligned region: 513..643
AAA_10 [PF12846], Evalue: 9.6e-07, Aligned region: 191..234
Protein Sequence: 709 a.a.     [Download]
>gi|304311449|ref|YP_003811047.1| unnamed protein product [gamma proteobacterium HdN1]
MVSSRIEGLLRPPIEFASAIAYSAVAGLMMAAPYELMMTPTVAAATGSGLLALAALRFRSAWRVFKYQKG
LKKLPHYSLAFDQLRVSKERLFIGKGFEWEPKHTQRMHECEQPGAERYIKPGKFYQLARWIDGRAEYSNV
MRSVSRLTRSSSRWNPVAPIADVGGYPAIHGVGLLERERDVYMKLSERVGHLLVLGTTRVGKTRFAEMLI
AQDIARGDVVIVFDPKGDAELMKRVYREAKRAGRLEQLYIFHLGYPEVSARYNPVGQFTRITEVASRIAG
QMPGDGASQAFREFVWRYVNVIAACRNALGVRPGIEQIKYDAENLEPLVVEYLEFLLERECRSGPLSNWK
KTIDDWAAAFDDAQEKEFRKPRHMGDRSSRAMALCKFYKDHKNDHRLHDTCAESLITTFFYDTAKFNMLI
ASLMPLMEKLCTGKCAELISPDYLDGDRHRPIFTWAEVIRTGGIVYVGLDALSDPEVAAAVGNSMFADLT
SGSGLLYKHGADHGLPFSVGGRRVYIHADEFNELVGKEFIPLLNKAGGAGYGVTAYTQTWSDVVARLGNE
AQAGQVAGNLNSLVMLRTIEYATIEMLTKRLRQVDVAHAMDVSGASDVSDPDANTSFSSRTEQRVTSQRV
ERVHPNDVLRLPKGQAFAMTDGGTLSKIRLPLPDPADLADLPRTLQDMSDDMAKHYRSDKNWYHFQSCFD
VPGAFNGLK
 
Nucleotide Sequence: 2130 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2269669-2267540 Gamma proteobacterium HdN1 chromosome, complete genome
GTGGTGAGCTCACGAATTGAAGGGTTGTTGAGGCCGCCCATTGAATTTGCTTCAGCGATTGCATACAGCG
CTGTTGCGGGTTTAATGATGGCTGCGCCTTATGAATTGATGATGACACCTACGGTGGCTGCGGCAACAGG
AAGTGGCTTGCTCGCGCTCGCGGCGTTACGATTTCGGTCTGCGTGGCGAGTATTTAAATACCAAAAGGGC
CTAAAAAAGCTGCCGCACTATTCGCTCGCATTCGATCAATTGCGCGTCAGCAAGGAGCGGTTGTTTATCG
GCAAGGGATTTGAGTGGGAACCCAAACACACGCAGCGAATGCACGAATGCGAGCAGCCCGGTGCCGAGCG
CTATATTAAACCCGGAAAATTCTACCAACTGGCGCGCTGGATTGATGGACGTGCGGAGTACAGTAACGTC
ATGAGGTCGGTGAGCCGTCTGACGCGGAGCTCGTCGCGCTGGAACCCCGTCGCGCCGATTGCGGATGTAG
GAGGCTATCCCGCCATTCACGGCGTGGGCCTGCTAGAACGCGAACGTGATGTGTACATGAAACTGTCCGA
GCGCGTAGGTCATTTGCTTGTGCTTGGAACGACCCGTGTCGGCAAAACCCGCTTTGCTGAAATGCTGATC
GCGCAGGATATTGCACGGGGCGACGTAGTCATCGTCTTTGATCCGAAGGGCGACGCCGAGCTGATGAAAC
GGGTGTACCGAGAAGCGAAGCGTGCCGGTAGACTGGAGCAGCTTTATATCTTTCATCTGGGCTATCCGGA
AGTTTCTGCACGTTACAATCCGGTAGGCCAGTTTACTAGGATCACGGAGGTGGCCTCACGCATTGCAGGC
CAGATGCCGGGGGATGGTGCCTCACAAGCCTTCCGTGAGTTTGTCTGGCGCTACGTGAACGTCATTGCAG
CGTGCCGTAACGCGCTCGGCGTGCGGCCGGGTATCGAGCAGATTAAATACGACGCCGAAAACCTCGAACC
GCTCGTCGTTGAGTATTTGGAATTTTTGCTTGAACGTGAGTGCCGGTCGGGGCCGTTGTCGAATTGGAAA
AAAACCATTGACGATTGGGCGGCGGCATTCGACGACGCTCAAGAAAAGGAGTTTCGCAAACCGCGACACA
TGGGCGACCGCAGCAGTCGTGCAATGGCGCTGTGCAAGTTTTACAAAGACCACAAAAATGATCATCGTTT
GCACGATACCTGTGCGGAGTCGTTGATCACGACGTTTTTCTACGATACGGCAAAATTCAACATGCTCATT
GCATCGCTGATGCCGCTCATGGAAAAGTTATGCACGGGCAAATGCGCGGAGCTGATTAGCCCTGATTATT
TAGATGGCGACCGACACCGCCCTATATTTACATGGGCGGAAGTGATCCGCACTGGCGGCATCGTCTACGT
GGGGCTGGACGCCTTGTCTGATCCGGAGGTGGCGGCGGCGGTAGGAAATTCAATGTTCGCGGATTTAACC
TCGGGTTCTGGTCTGCTGTACAAACACGGTGCCGATCACGGTTTGCCGTTTTCCGTCGGCGGGCGGCGCG
TCTATATCCATGCGGATGAATTTAACGAGCTGGTGGGCAAGGAGTTTATCCCGTTGTTGAACAAGGCGGG
GGGTGCGGGTTATGGCGTGACGGCGTACACGCAGACATGGTCAGATGTGGTTGCCCGCTTGGGTAACGAA
GCTCAAGCAGGGCAAGTGGCGGGAAACTTAAACTCGCTGGTGATGTTGCGCACGATCGAATACGCGACGA
TCGAAATGCTGACAAAGCGGCTGCGGCAGGTGGACGTGGCCCATGCGATGGATGTATCGGGCGCCTCTGA
TGTGAGCGACCCAGATGCGAATACGTCGTTCTCCTCACGAACAGAGCAGCGTGTGACGTCGCAGCGCGTG
GAGCGTGTCCATCCAAACGACGTACTTCGGTTGCCCAAAGGCCAAGCGTTTGCGATGACAGATGGCGGCA
CGCTTTCAAAAATCCGGCTCCCATTACCTGACCCGGCAGATTTGGCCGATTTACCTCGTACCTTGCAAGA
TATGTCGGACGATATGGCGAAGCATTACCGCTCTGACAAAAATTGGTATCACTTTCAATCGTGCTTTGAC
GTACCGGGAGCGTTCAATGGCCTCAAATGA