SecReT4
Protein ID: 304311452
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18200
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2270797..2271696 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDE1VKR1
KEGG IDgpb:HDN1F_18200, gpb:HDN1F_34990
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 299 a.a.     [Download]
>gi|304311452|ref|YP_003811050.1| unnamed protein product [gamma proteobacterium HdN1]
MLAMCLPRFYQRVSALCRMERGTRMRINKKGLCPTSLAVMLCCYGASGAFASDLSRSAMVQARAATSDSV
AFWSSIPVETAMQEWSLSADEWSRYLALMQGRARYYAERMPPPMVLAMYARDEEERNRYAEAMVQFEYDK
AGRLLAVQRAYETAMQRMHPNEKIIDFDLLRARGIRLPGEADPVSAALGDTSDGSQADHTPKLGDQIVLF
AAAGCEDACGKKIRTLVERYPYAPLEVYFIGVDGHLLKRWLDAAKLDMNQLKNAGVTLSRDEGQATQYNA
EPGTTFVVRGGGLYEIDVK
 
Nucleotide Sequence: 900 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2271696-2270797 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCTTGCCATGTGCCTGCCACGATTTTACCAGCGCGTATCCGCACTTTGTCGGATGGAGAGGGGCACAA
GGATGCGTATTAATAAGAAGGGCCTCTGCCCCACGTCTTTGGCGGTGATGCTCTGTTGTTATGGTGCGTC
AGGAGCATTTGCCAGCGACCTATCGCGCAGCGCGATGGTTCAGGCGCGCGCTGCTACGAGTGATTCCGTC
GCGTTTTGGAGCAGTATTCCTGTAGAAACGGCGATGCAGGAATGGTCGCTGAGCGCGGATGAGTGGTCAC
GTTATTTAGCTCTGATGCAGGGGCGTGCACGCTACTACGCGGAGCGTATGCCGCCACCGATGGTGCTGGC
GATGTATGCGAGGGATGAGGAGGAGCGTAATCGCTATGCGGAAGCGATGGTGCAGTTCGAGTACGACAAA
GCGGGGCGCCTGCTGGCTGTTCAACGCGCGTACGAAACAGCGATGCAACGGATGCATCCTAATGAAAAAA
TAATCGACTTCGACCTATTGCGGGCGCGTGGCATTCGATTGCCAGGAGAGGCTGACCCAGTGTCCGCTGC
TCTTGGCGATACAAGCGATGGTTCGCAGGCTGACCATACGCCGAAATTAGGTGATCAGATCGTTTTGTTT
GCTGCGGCAGGCTGCGAGGATGCGTGCGGCAAAAAAATTCGAACGCTCGTAGAACGCTATCCATACGCAC
CGCTGGAGGTGTATTTCATCGGTGTGGATGGGCACCTACTAAAGCGCTGGTTGGATGCAGCGAAGCTAGA
TATGAATCAGCTAAAAAATGCCGGGGTTACCCTGTCACGCGATGAGGGACAGGCGACTCAGTACAACGCT
GAACCGGGCACGACATTTGTCGTGCGCGGCGGTGGCCTCTACGAGATCGACGTGAAGTGA