SecReT4
Protein ID: 304311454
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18220
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2272796..2273290 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDE1VKR3
KEGG IDgpb:HDN1F_34970, gpb:HDN1F_18220
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 164 a.a.     [Download]
>gi|304311454|ref|YP_003811052.1| unnamed protein product [gamma proteobacterium HdN1]
MMRTVAPNRHGGCFVQILRPLGGLLGGAIFITSVTAAHADDISVGYALISPTATADQTDLLSVVIQHDFP
AQITTVGDAIHQLLERSGYRLAFGAVADPDLPILLDLPLPMVHRKLHQIRLRTALQTLAGEAWVLVEDPV
NRLISFDLRERRPAQQQAAEAKGV
 
Nucleotide Sequence: 495 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2273290-2272796 Gamma proteobacterium HdN1 chromosome, complete genome
GTGATGCGTACTGTGGCACCTAACCGACATGGAGGATGTTTTGTGCAGATTTTACGACCGCTGGGCGGCC
TACTAGGTGGGGCTATTTTTATCACGAGCGTGACCGCCGCGCATGCTGACGATATTTCGGTGGGGTACGC
CCTGATTTCGCCTACGGCGACGGCTGATCAGACTGATCTACTGTCGGTGGTGATACAGCACGATTTTCCG
GCGCAAATTACGACGGTTGGAGATGCCATTCACCAACTGTTGGAACGATCGGGTTATAGGCTCGCGTTTG
GTGCGGTTGCTGACCCAGATTTGCCCATTTTGTTGGACTTACCGCTGCCCATGGTACACCGAAAGCTGCA
TCAGATACGTCTGCGCACTGCATTACAGACACTAGCAGGCGAAGCGTGGGTGCTGGTCGAGGATCCCGTG
AATCGGTTGATCAGCTTCGATCTGCGTGAGCGCCGACCGGCGCAACAACAGGCGGCGGAGGCGAAGGGCG
TATGA