SecReT4
Protein ID: 304313116
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35010
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4242674..4243222 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDE1VKQ9
KEGG IDgpb:HDN1F_18180, gpb:HDN1F_35010
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.4e-28, Aligned region: 58..181
Protein Sequence: 182 a.a.     [Download]
>gi|304313116|ref|YP_003812714.1| unnamed protein product [gamma proteobacterium HdN1]
MQVLACAALALVAAPSVLAAPSVVFDAGAAFSEPITRYTHVLDPQKRFQVPEDPAAKQRLQQQLLERIRE
HGGQMIRLPIRTPSMSPAPIKTQDAYYTNLLMPIFVVGADQHSLQWLRAWRETLTRIGAMGWVVQADSAE
DMQAIAEAGAGLKMLAQSGEAIPRVFGVSSYPVLITSRSIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4242674-4243222 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCAGGTGCTCGCGTGCGCAGCACTCGCTTTGGTTGCGGCACCGTCCGTACTGGCGGCACCGTCCGTGG
TTTTTGATGCAGGGGCGGCATTTTCTGAGCCGATCACTCGGTATACGCATGTGTTAGATCCACAAAAGCG
GTTTCAGGTCCCTGAGGATCCGGCGGCAAAGCAACGATTGCAGCAGCAATTGCTAGAACGGATTCGTGAG
CACGGAGGGCAGATGATTCGCCTGCCGATCCGCACGCCCTCAATGAGCCCAGCACCGATCAAGACCCAAG
ATGCGTATTACACCAATTTGCTCATGCCGATTTTTGTCGTCGGGGCCGATCAACACTCGCTGCAATGGCT
GCGAGCGTGGCGCGAAACCTTGACGCGCATCGGGGCCATGGGCTGGGTGGTGCAGGCGGATAGCGCCGAG
GACATGCAGGCCATCGCAGAGGCAGGTGCGGGGCTGAAGATGCTAGCGCAGAGCGGTGAGGCGATTCCCA
GAGTATTTGGTGTTTCATCGTACCCCGTACTGATCACCAGTCGTTCCATCGAACAATAA