SecReT4
Protein ID: 304313124
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35090
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4248551..4249381 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDE1VKQ1
KEGG IDgpb:HDN1F_18100, gpb:HDN1F_35090
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.7e-34, Aligned region: 16..274
Protein Sequence: 276 a.a.     [Download]
>gi|304313124|ref|YP_003812722.1| unnamed protein product [gamma proteobacterium HdN1]
MRLNFLRGWMLTFLVVFVTPAISQEQEPQETLVWNRAPLRIVLPVSSERQIDFPAEVDVYLLESLANTLH
VTATPEGSTFWTASDKFGTERMMVTDKSGQMQWLVDVSAEPNAPTHRLTIRDSRFTAKAETLAAVESSEQ
APSQMPGSTGVVLDEVDVVRAVARQFYGPTRLAEMPAGISRVGAKTGEVPIYRGAPLTTEVLGAWRAMSD
GSDLYVTAIKVSNRASYEIRPDPRRISVRIRAMAAQHSWLAPAGEAPYDSTLWYLVSDRPLQETTL
 
Nucleotide Sequence: 831 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4248551-4249381 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCGTTTGAATTTTCTGCGGGGCTGGATGCTCACTTTTTTAGTGGTGTTTGTAACGCCCGCAATAAGCC
AAGAACAGGAACCGCAGGAAACATTAGTGTGGAATCGTGCGCCTCTCCGAATCGTCTTGCCCGTAAGTAG
TGAGCGGCAAATTGATTTCCCAGCGGAGGTGGATGTATATCTGCTTGAATCACTGGCCAATACGTTGCAC
GTTACTGCAACGCCAGAAGGTTCGACGTTTTGGACAGCCTCAGACAAATTTGGCACCGAGCGAATGATGG
TGACAGATAAAAGTGGACAAATGCAGTGGCTCGTGGACGTAAGCGCAGAACCCAATGCGCCGACCCACAG
GCTAACCATTCGAGATTCGCGATTCACAGCCAAAGCTGAAACGCTGGCTGCGGTCGAGTCCTCCGAACAA
GCCCCGTCGCAAATGCCGGGGAGCACCGGTGTCGTGCTGGATGAAGTGGATGTCGTGCGAGCCGTCGCAC
GCCAATTCTACGGCCCAACACGATTGGCTGAAATGCCCGCAGGGATCAGCCGTGTCGGCGCTAAAACAGG
TGAGGTGCCCATTTATCGGGGAGCGCCCCTAACGACGGAAGTGCTGGGCGCGTGGCGGGCCATGTCCGAT
GGCAGCGATCTGTATGTCACCGCAATAAAAGTCAGCAACCGCGCATCGTATGAAATCCGGCCCGATCCTC
GGCGAATCAGCGTTCGCATTCGGGCGATGGCGGCACAGCATTCGTGGCTGGCCCCTGCAGGAGAGGCCCC
ATACGACAGCACGCTCTGGTACCTCGTTAGCGATCGTCCGTTGCAGGAAACCACACTATGA