SecReT4
Protein ID: 304313125
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35100
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4249378..4250907 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDE1VKQ0
KEGG IDgpb:HDN1F_35100, gpb:HDN1F_18090
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.5e-05, Aligned region: 373..481
Protein Sequence: 509 a.a.     [Download]
>gi|304313125|ref|YP_003812723.1| unnamed protein product [gamma proteobacterium HdN1]
MNKFIPIILLCVCGIVAVIGVLSLRGGSDEPKVSATQSPPPLPDGHVARPDAMEISDAIAYNTQLQGAAA
EVQSLRRSVQEYAATTEQKIAEATRKTVQYELPKIELRLREELRKEAQAQLPKEPILPPTQTNRVVDAPA
ITRPTPAPTTNNTGRLLVNSSSDIPPGFGFDGVDLSRARNNANVLLNMQPPSAGVAPSGMPGYVKISAWR
PNSLSNPLPTANGGAVRNAAFPNATNNGDRVLDRTADATAQKNAKKPEPLPVYTIENTSTLFSNTTMTAL
MGVVPNRNNAIKNMMRFKLITGAENIASNGLVLPDVKNIVWTGYAIGNREMECVQATVDTVTFTFQDGTI
RTVSEKQAGGAGGQLSEGLGYLSDRWGKPCIKGTLISNATQYLRDRMIAAGAAATAAAAAAAETTTQRDG
VGGGTSTAVTGDMGNYIAGQTGTATLNELAAYLRDRMDQAVDIIYLDAGKDVTIHVEKEITIDYDPAGRK
LSHIAMRSSQGPTARMRLD
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4249378-4250907 Gamma proteobacterium HdN1 chromosome, complete genome
ATGAACAAGTTCATCCCGATTATTCTATTGTGTGTGTGCGGGATCGTTGCCGTCATTGGCGTGTTATCCC
TTCGCGGTGGCTCAGATGAGCCAAAGGTGAGCGCCACACAATCGCCTCCCCCGCTTCCCGACGGACATGT
GGCCCGCCCTGATGCGATGGAAATTTCAGATGCCATTGCGTACAACACGCAGCTCCAAGGGGCGGCCGCC
GAAGTGCAGTCCTTGCGCCGCAGTGTTCAGGAGTACGCGGCGACTACCGAGCAAAAAATTGCCGAGGCCA
CGCGCAAAACCGTCCAATATGAACTGCCTAAAATTGAACTTCGATTGCGCGAAGAATTGAGAAAAGAGGC
GCAGGCACAACTCCCCAAAGAGCCGATTTTGCCGCCGACACAAACCAACCGAGTAGTGGACGCACCGGCG
ATTACACGGCCGACGCCTGCACCCACCACAAACAACACAGGGCGCTTGTTGGTAAATAGCAGCAGTGACA
TACCACCCGGTTTTGGATTTGATGGGGTGGATCTCAGCCGTGCACGGAACAACGCCAACGTACTCTTAAA
CATGCAACCACCCTCAGCAGGTGTCGCGCCGTCGGGAATGCCTGGGTACGTTAAAATCAGTGCATGGCGG
CCTAACAGCCTCAGCAATCCATTGCCTACCGCCAATGGCGGCGCGGTACGCAATGCCGCGTTTCCGAATG
CCACGAATAACGGAGATCGCGTACTGGATCGCACCGCAGATGCGACTGCACAGAAGAATGCGAAAAAACC
TGAACCGCTACCGGTCTATACCATTGAAAACACTTCAACGCTGTTTTCAAACACCACGATGACCGCGCTG
ATGGGGGTGGTGCCCAACCGTAACAACGCGATTAAGAACATGATGCGGTTTAAGCTGATCACGGGCGCTG
AAAACATCGCCTCCAACGGTCTGGTTTTGCCGGATGTAAAAAACATCGTATGGACAGGCTATGCGATTGG
TAATCGTGAGATGGAATGCGTGCAGGCAACCGTCGATACCGTCACGTTCACGTTCCAAGACGGCACCATA
CGCACGGTCAGTGAAAAACAAGCGGGTGGTGCGGGCGGGCAGCTCTCGGAAGGTTTAGGGTATCTCTCCG
ATCGCTGGGGAAAACCCTGCATTAAAGGCACATTAATTTCCAATGCGACACAATACCTGCGCGACCGGAT
GATCGCGGCAGGTGCAGCCGCCACGGCGGCAGCGGCAGCAGCAGCGGAAACCACAACCCAGCGGGATGGT
GTGGGTGGAGGTACCTCAACGGCTGTCACGGGGGATATGGGAAATTACATCGCTGGTCAGACAGGTACGG
CAACACTCAATGAGCTGGCTGCCTATCTGCGCGATCGTATGGATCAAGCGGTAGACATCATTTACCTCGA
TGCTGGCAAAGACGTCACGATTCACGTTGAGAAGGAAATCACCATCGACTACGACCCAGCAGGCCGTAAG
TTATCGCATATCGCCATGAGGTCATCGCAAGGCCCGACGGCAAGGATGCGTCTGGATTAA