SecReT4
Protein ID: 304313128
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35130
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4252485..4255340 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDE1VQK4
KEGG IDgpb:HDN1F_35130, gpb:HDN1F_18050
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.4e-38, Aligned region: 514..870
TraC_F_IV [PF11130], Evalue: 5.6e-33, Aligned region: 49..318
FtsK_SpoIIIE [PF01580], Evalue: 7.5e-05, Aligned region: 509..543
Protein Sequence: 951 a.a.     [Download]
>gi|304313128|ref|YP_003812726.1| unnamed protein product [gamma proteobacterium HdN1]
MPSANTVKKSAKPAANWLQRLSGQRPWRGRAPLTEKDYAKLWDGPKHAIPDYLPWVDFDDEKKVFLLNDG
VSVGAVFELRQVNVEGKSSEFIGKVQQALKRALAGVPEVYEGNPWIVQIYLQDEPIESLVQEMQRYAKPA
ARESQHSKEWFNLLEEHVRQMSREQGIFEDELAGIRWRGLTRRVRLVLYRYTERGEWLTEDNTLKRSNRS
PSRELNQAARVFTRALQGAGVAVKRLEGAAFFEWMGPFCSPNPVHAKDGYEWVRSVKRYPAPGKRTATYD
FGQAVFAEEPRTDEDGRFWFCDQPTRFLSITPLETTPDVGVITAEIKNASGKEVSLWDELPRGSLFTMTI
VIESQLHIKHHLEDIIQSGGRATREAEMATDQAQHALNYLAEGNRIYRVYPGVYLRGDTDAALEDAMLNT
MTILSQAGLSVIPPKWDLAPIDAFLRALPMAYHYTYDRARLKRAWLCDADDLTALLPLYGRSTGTGNPGF
FFFNRVGEPLLVDPFNKRDRTKTAHLLLFGPTGSGKSATANYLLQHIAAIHDPRLFIIEKGNSFGRLGKH
FAGMGKTVNHIRFTPSLNISLPPYAETSRALEQLEFQEEMRKSREKMAANGEVDDAISFQVDAEAIDDGE
DDEDDQRDFLGEMVNLTILMVTGASKREEEHLSQADRALLKECLIEGLLASARRGAPHALPQDVVDVMNE
RLKIPSTDEHQRLRLRDMSTALGKWTSGIHGHYFNRYGESWPEADCTIVDMGILTGNNNDDMLAVALISL
INTITGLGEKYQHVQGARETIVLIDEGHVITKNPVLAKPLVFGLKTWRKLAIWLWQATQNLADYPDEAEV
MLALAEWWICLTMESEQEIKQIARFKPLTEDERALLVSARKQDGAFTEGVILGSKIKALFRVVMPALPLV
LSMTDVDQKKAIAELARKHGISEIAAAHMMAKKIIQAREQA
 
Nucleotide Sequence: 2856 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4252485-4255340 Gamma proteobacterium HdN1 chromosome, complete genome
ATGCCGAGTGCGAACACGGTCAAAAAATCCGCCAAACCCGCCGCCAATTGGCTGCAACGCCTGTCAGGGC
AACGTCCGTGGCGCGGTCGTGCGCCGTTGACCGAGAAAGACTACGCCAAACTTTGGGATGGCCCCAAACA
CGCCATTCCCGATTATTTGCCGTGGGTCGATTTTGACGATGAAAAGAAAGTATTTTTGCTTAACGACGGC
GTAAGTGTTGGCGCCGTTTTTGAGTTGCGCCAAGTGAATGTTGAAGGGAAATCCTCGGAATTTATTGGCA
AAGTGCAGCAGGCGCTCAAGCGGGCGCTGGCAGGCGTGCCGGAAGTCTACGAAGGCAACCCGTGGATTGT
GCAAATCTACCTGCAAGACGAACCGATCGAATCGCTGGTGCAGGAGATGCAGCGTTACGCAAAGCCTGCG
GCACGGGAAAGCCAGCACTCCAAAGAATGGTTCAACTTGTTGGAGGAGCATGTTCGCCAGATGTCACGCG
AGCAGGGGATTTTTGAGGACGAACTGGCGGGGATCCGCTGGCGCGGCCTCACCCGACGGGTGCGCTTGGT
GCTATATCGCTACACCGAGCGCGGCGAGTGGCTGACGGAAGATAATACGCTGAAACGCTCCAATCGCAGC
CCCAGCCGTGAACTCAATCAAGCGGCCCGCGTGTTTACACGAGCGCTACAGGGTGCAGGCGTGGCTGTAA
AGCGTCTGGAGGGCGCCGCATTTTTTGAGTGGATGGGGCCGTTTTGCTCACCTAACCCCGTACACGCCAA
AGATGGTTATGAGTGGGTACGCAGTGTAAAACGCTATCCAGCACCGGGAAAGCGCACCGCCACCTACGAT
TTTGGGCAAGCGGTTTTTGCAGAAGAGCCGCGCACGGATGAGGACGGACGGTTTTGGTTTTGCGACCAGC
CCACACGCTTTCTGTCGATCACCCCACTGGAAACGACACCCGATGTTGGCGTGATTACCGCCGAAATTAA
AAATGCCAGCGGCAAAGAAGTCTCGTTGTGGGATGAGCTGCCGCGTGGCTCGCTATTCACGATGACCATC
GTGATCGAATCGCAACTGCACATTAAACATCACCTCGAAGACATCATTCAGTCCGGTGGTCGTGCGACGC
GAGAGGCGGAAATGGCCACCGACCAAGCCCAGCATGCGCTCAACTATTTGGCCGAAGGCAACCGAATTTA
CCGAGTGTACCCTGGCGTTTATTTACGGGGTGATACCGACGCTGCACTCGAAGATGCCATGTTAAACACC
ATGACCATCCTGTCGCAGGCGGGCCTGTCGGTCATTCCGCCCAAATGGGATTTAGCACCGATCGACGCTT
TTTTGCGGGCGTTACCGATGGCCTATCACTACACCTACGACCGTGCCCGCCTCAAGCGCGCATGGCTGTG
CGATGCCGATGACCTCACTGCACTCTTGCCGTTATATGGTCGCTCTACCGGCACTGGAAACCCCGGCTTT
TTCTTCTTTAACCGTGTGGGTGAGCCGCTGTTGGTCGATCCTTTTAATAAGCGCGACCGCACGAAAACCG
CTCACTTACTGCTGTTCGGGCCAACAGGTTCTGGTAAATCTGCGACGGCAAACTACCTGCTACAGCATAT
TGCGGCCATTCATGACCCACGACTGTTCATCATTGAGAAAGGCAACAGTTTTGGGCGTCTAGGCAAGCAT
TTTGCCGGCATGGGCAAAACCGTGAACCACATTCGCTTTACTCCCTCGCTCAACATATCGCTGCCGCCTT
ATGCAGAAACTTCGCGTGCGCTGGAGCAACTGGAATTTCAGGAGGAGATGCGAAAATCGCGTGAAAAAAT
GGCCGCCAATGGTGAGGTGGATGATGCGATTAGCTTTCAGGTAGACGCTGAAGCCATCGACGATGGAGAA
GATGATGAGGACGATCAGCGCGATTTTCTTGGTGAGATGGTCAACCTCACCATTTTAATGGTCACCGGTG
CCAGCAAGCGCGAAGAAGAGCATCTGTCGCAGGCAGATCGTGCGCTGTTAAAAGAATGCCTCATTGAAGG
ACTGCTGGCCAGCGCCCGACGCGGGGCGCCTCACGCATTGCCGCAAGACGTGGTTGATGTGATGAATGAG
CGCCTGAAAATCCCCAGTACCGATGAGCATCAACGGCTGCGTTTACGCGACATGAGTACGGCGCTCGGCA
AGTGGACGTCGGGTATTCATGGCCATTACTTCAACCGTTATGGAGAAAGTTGGCCAGAGGCGGATTGCAC
CATCGTGGATATGGGGATTCTTACCGGTAACAACAACGACGACATGCTAGCCGTCGCGCTGATTTCCCTG
ATCAACACGATCACAGGGCTGGGGGAGAAATACCAGCATGTGCAAGGGGCACGCGAAACCATCGTGTTAA
TCGACGAAGGCCACGTGATCACCAAAAACCCTGTACTCGCCAAACCCTTAGTGTTTGGCCTGAAAACATG
GCGGAAGCTGGCGATTTGGTTGTGGCAAGCGACGCAAAACCTCGCCGACTACCCCGATGAGGCCGAGGTG
ATGCTCGCGTTGGCCGAGTGGTGGATCTGCCTCACGATGGAATCCGAGCAGGAAATCAAACAAATTGCGC
GATTCAAACCACTGACAGAAGACGAGCGAGCCTTGCTAGTCAGCGCCCGAAAACAGGATGGCGCATTTAC
CGAAGGCGTAATTCTGGGCTCAAAAATCAAAGCGCTGTTCCGTGTCGTGATGCCCGCCTTGCCACTCGTG
CTGTCCATGACCGACGTCGATCAGAAGAAAGCGATTGCTGAGCTGGCACGTAAGCACGGCATCTCTGAAA
TCGCCGCCGCCCACATGATGGCCAAGAAAATCATCCAAGCACGGGAGCAAGCATAA