SecReT4
Protein ID: 304313129
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35140
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4255342..4255827 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDE1VKP5
KEGG IDgpb:HDN1F_35140, gpb:HDN1F_18040
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 3.6e-17, Aligned region: 61..152
Protein Sequence: 161 a.a.     [Download]
>gi|304313129|ref|YP_003812727.1| unnamed protein product [gamma proteobacterium HdN1]
MARSIHQSNHQSKSKYKKYAGIPLLLFGLSTVTLAADRIEVTYFGNDQYPPQQVEWAKAQPDLQVVIVNL
DDHRNLENELSKDLPNNDPEKAMAIARERVLAVEQARWDTLFSGPIKAKEWQVQRIPAVVFGQGKQVVYG
VTDLQKAVGEWRGVHLDAAHR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4255342-4255827 Gamma proteobacterium HdN1 chromosome, complete genome
GTGGCTCGATCTATTCACCAGTCAAATCACCAGTCAAAATCAAAATACAAAAAATATGCGGGAATCCCAC
TGCTGCTGTTTGGGTTAAGCACGGTGACGCTCGCCGCCGACCGCATTGAAGTGACCTATTTTGGCAACGA
TCAATACCCACCCCAGCAAGTGGAGTGGGCAAAAGCGCAACCTGATCTGCAGGTCGTCATCGTAAACCTT
GACGACCACCGCAATCTCGAAAACGAGCTCTCTAAAGATTTACCGAATAACGATCCCGAGAAGGCCATGG
CGATTGCCCGTGAGCGTGTGCTGGCCGTAGAGCAAGCGCGTTGGGATACGCTCTTTTCTGGCCCGATTAA
AGCCAAAGAATGGCAAGTGCAACGAATTCCGGCAGTGGTTTTTGGGCAGGGCAAGCAGGTCGTGTACGGC
GTTACCGATTTGCAAAAGGCAGTTGGAGAATGGAGAGGAGTGCATCTCGATGCGGCACACCGTTAA