SecReT4
Protein ID: 304313130
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35150
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4255859..4257184 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDE1VKP4
KEGG IDgpb:HDN1F_35150, gpb:HDN1F_18030
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3e-31, Aligned region: 36..423
Protein Sequence: 441 a.a.     [Download]
>gi|304313130|ref|YP_003812728.1| unnamed protein product [gamma proteobacterium HdN1]
MLSGSQAMVAAPVSQTVPVSGANIVDLIKVGLTGISGGCLNYCITGICVHYNGLKVIISPRIAHNTSEFT
VSSFRAQGQQPWIEWKRVFGNIQASLANGIFGTLLGTGQIGGYGTYTEEHKENDRQLPFKEVDINGHPLA
LLPMLLGSGGMTAGGATQPPTEADFTEAQTAAGSMVDASDFAAMFMNSEILDVFSYMNTMNQIGTMASEM
SEVMDYLSSMQDLASGMGGSGSYDLLCESTVTPFIPFYLSAIDTLTWRLPWPDVLTHSVDLAYGMTPFLP
NRKVIGTPDAMPTLTNGVWAGLYPRIGFVNQEHDGKVGAVASQRALDLVLAEDGNDHFGHVTLFNPGFAN
QRDWHIIPYEFHASGVKGGVWQQVHPIPKAECRPSLYRDRELSDTAEDHSAPVVLGGDQNYIWAFWRRYE
CCMNRKGVFIGAIPTPDICLF
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4255859-4257184 Gamma proteobacterium HdN1 chromosome, complete genome
GTGCTGTCAGGCAGTCAGGCCATGGTCGCCGCCCCCGTTTCACAAACGGTGCCCGTCAGTGGCGCAAATA
TCGTCGATCTGATTAAAGTCGGGCTCACCGGAATCTCCGGTGGGTGCCTGAACTATTGCATCACCGGTAT
TTGCGTCCACTACAACGGCCTCAAGGTCATCATCAGCCCGCGAATTGCGCATAACACCTCAGAATTTACC
GTGTCCTCCTTTCGGGCGCAGGGCCAGCAGCCGTGGATCGAATGGAAGCGTGTGTTTGGCAATATACAGG
CCAGTTTAGCCAACGGTATTTTCGGTACGCTGCTCGGCACAGGGCAGATTGGTGGATATGGCACCTACAC
CGAAGAGCACAAAGAAAACGACCGCCAATTGCCATTCAAAGAAGTCGATATTAACGGCCATCCGCTGGCG
CTGCTGCCCATGCTATTGGGTTCAGGTGGGATGACCGCAGGTGGAGCCACCCAACCGCCTACAGAGGCTG
ACTTTACCGAAGCACAAACTGCGGCAGGCAGCATGGTAGATGCCTCAGATTTTGCCGCAATGTTCATGAA
CTCCGAAATCCTCGACGTATTTTCGTACATGAATACGATGAACCAAATCGGCACCATGGCGAGTGAAATG
AGCGAGGTGATGGACTATCTGTCGTCCATGCAGGATCTGGCTTCGGGCATGGGGGGGAGTGGCAGTTACG
ACTTGCTCTGCGAGAGTACAGTAACGCCGTTCATTCCGTTCTATTTAAGCGCCATCGACACGCTGACGTG
GCGCCTACCGTGGCCGGATGTACTGACTCATTCGGTGGACTTGGCGTATGGTATGACGCCTTTCTTGCCG
AACCGTAAAGTGATCGGCACCCCTGATGCTATGCCGACACTCACCAACGGCGTGTGGGCAGGGCTTTATC
CGCGCATTGGATTTGTTAACCAAGAACACGATGGCAAAGTGGGCGCGGTGGCGTCCCAGCGTGCCCTTGA
TCTTGTCTTGGCCGAGGACGGAAACGATCATTTTGGCCACGTCACACTTTTTAATCCCGGCTTTGCCAAC
CAGCGCGACTGGCACATCATCCCCTACGAATTTCATGCCAGCGGCGTGAAAGGCGGAGTGTGGCAGCAGG
TGCATCCCATCCCCAAAGCGGAGTGCCGCCCCTCTCTGTACCGTGACCGAGAGCTCAGTGATACCGCAGA
AGATCACAGCGCACCGGTCGTGCTGGGTGGCGACCAAAACTACATCTGGGCGTTTTGGCGGCGGTATGAG
TGCTGCATGAATCGCAAAGGCGTATTTATTGGTGCAATCCCAACGCCCGATATTTGCCTGTTCTAG