SecReT4
Protein ID: 304313132
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35170
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4258681..4260561 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDE1VKP2
KEGG IDgpb:HDN1F_18010, gpb:HDN1F_35170
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.1e-28, Aligned region: 11..407
TraG_N [PF07916], Evalue: 4.1e-28, Aligned region: 455..602
Protein Sequence: 626 a.a.     [Download]
>gi|304313132|ref|YP_003812730.1| unnamed protein product [gamma proteobacterium HdN1]
MYVGSAAELNLIAFGWMLYDNLWALLAFVGLVMVPFTWTLFMAVFDAVKKHGFSGPDAPITAFYSVFASF
MVMMLVYVVACIPMVSLSVDKWEYSQICTANGVEQVEGRTLRGDETLVTAAGQLISGSLKPVDAKVPILW
DVIQRIGAGMSRALNSGGACPNNSTYMDGAMRKLKFAGDPSLQGELAQFTKDCFLPARSRLMSSLESGTL
TTVPTPAAAVDRDQYYAAKYREWTQKPKTNDEVFDRSNDPNYIGSHFYLSVPGLYAPAQPGQYDIQGDTL
RASKPVAGWSYDPVRDCSHSNDAAGDFCTNHARNEDLRKNRASPTCDEWWNDSEIGLKRKLFEAADTSVS
LYNNGPVDPNTLQTPTTQISASEALNSAITQTTGASKSKAWLEDKIIATAMVNDSNSLKAIETATKDLTA
YEGPPINAESPLIVRIGVGFAAVAAMAFSAVAAEAATAAAASAAVSIAGSAAEFYAFTYMVKSVYPIAIA
YIEMFFIAMLPFMMVASMYDLGRLLQFALIFLAIQFLSPWRYIVEYLDERLFSLMYPDNTLWGTAATLVD
RILLDVTTSGMYIVFPIVLLWLITLAGAGSTSGIIGALSTNGAATIIKGASSSTKAPASKKPKAKK
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4258681-4260561 Gamma proteobacterium HdN1 chromosome, complete genome
ATGTATGTAGGTAGCGCTGCCGAGCTGAACCTGATTGCCTTTGGGTGGATGCTATACGACAACCTGTGGG
CGTTATTAGCCTTTGTGGGGCTGGTCATGGTACCGTTCACATGGACTCTGTTCATGGCGGTATTTGATGC
CGTCAAAAAGCACGGTTTTTCCGGGCCAGATGCACCGATCACGGCCTTTTACTCGGTCTTTGCGTCCTTC
ATGGTGATGATGCTGGTGTATGTTGTTGCCTGCATCCCCATGGTGTCACTCAGCGTGGATAAATGGGAAT
ACAGCCAAATCTGCACCGCCAACGGTGTAGAGCAGGTGGAAGGCCGCACGCTCCGAGGCGATGAAACGCT
GGTCACCGCCGCAGGTCAGTTAATCAGCGGCTCACTTAAACCGGTCGATGCCAAAGTGCCGATTCTGTGG
GATGTGATCCAACGCATCGGTGCAGGCATGAGCCGTGCGCTGAACTCCGGCGGCGCATGCCCGAATAATT
CGACATATATGGATGGCGCCATGCGTAAGCTAAAGTTTGCAGGCGATCCGAGCTTGCAAGGGGAGCTTGC
TCAATTCACCAAAGACTGCTTTTTACCTGCCCGCAGCCGCCTGATGAGTTCATTGGAAAGCGGCACACTT
ACCACCGTACCGACGCCGGCGGCAGCGGTCGATCGAGATCAGTACTATGCGGCGAAATATCGGGAATGGA
CGCAAAAGCCAAAAACGAACGATGAGGTATTTGATCGCAGCAATGACCCGAATTACATTGGCAGCCATTT
TTATTTGAGCGTGCCGGGTCTGTATGCACCTGCACAACCGGGCCAGTACGACATACAGGGAGACACGCTG
CGGGCCAGCAAACCCGTGGCAGGATGGTCTTACGATCCCGTGCGCGATTGCAGCCATAGTAACGACGCTG
CTGGTGATTTCTGTACAAATCATGCTCGAAACGAGGACTTGAGAAAGAATCGAGCGTCGCCCACCTGTGA
TGAGTGGTGGAATGATTCTGAAATCGGCCTGAAGAGAAAATTGTTTGAGGCGGCAGATACTTCTGTATCT
TTATATAACAACGGTCCCGTGGATCCTAACACCCTTCAAACCCCCACCACGCAGATCAGTGCAAGTGAGG
CACTCAATAGCGCCATTACGCAAACCACTGGGGCGAGCAAATCGAAAGCGTGGCTAGAGGATAAAATTAT
TGCAACGGCGATGGTGAATGACTCAAACTCACTGAAAGCCATAGAAACTGCCACGAAGGATTTGACGGCA
TACGAAGGCCCCCCAATCAACGCTGAAAGTCCTCTTATTGTTAGGATAGGTGTAGGTTTTGCGGCTGTTG
CTGCCATGGCGTTTTCGGCGGTGGCTGCTGAAGCAGCGACTGCAGCCGCTGCATCAGCAGCGGTGTCCAT
TGCTGGGAGTGCAGCAGAATTTTACGCATTCACCTACATGGTAAAGAGCGTTTATCCGATTGCGATTGCG
TACATCGAAATGTTTTTTATTGCAATGCTACCGTTCATGATGGTCGCAAGCATGTACGATTTAGGCAGGC
TGTTACAGTTTGCGTTAATCTTTTTAGCGATACAATTTTTGTCGCCGTGGCGTTATATCGTTGAGTACCT
AGATGAGCGCTTGTTTAGCTTGATGTATCCAGACAACACGTTGTGGGGTACAGCTGCTACGCTGGTTGAC
AGGATATTGCTGGATGTTACAACGTCTGGAATGTATATCGTATTTCCAATAGTTCTTCTCTGGCTAATCA
CGCTTGCGGGTGCTGGCAGCACAAGCGGCATAATTGGAGCACTGAGCACAAATGGCGCTGCTACGATTAT
TAAAGGGGCCAGTAGTTCAACCAAGGCTCCAGCATCAAAAAAACCAAAAGCTAAAAAATAG