SecReT4
Protein ID: 305667834
T4SS name [ID]Tra_I [165]
Gene symboltrbB
Locus tagpCT_054
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]37727..38851 [-]
Productconjugal transfer protein
Component typeTrbB_I
UniProt IDE0WGZ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 4.5e-06, Aligned region: 222..337
Protein Sequence: 374 a.a.     [Download]
>gi|305667834|ref|YP_003864308.1| conjugal transfer protein [Escherichia coli]
MTIHYTATLNNKHLSLTALYPDGNREVIAILPVTELGALINRNNRLMHLSFSSPFREITETVLVDTVDAE
RPGHHIGRMLSAIDACLDAEYAGKGKHPSRKNGFWRTLMCGFIAGIALPATVAGYHWMKAESPSTLAYPT
SQEWRAEPVTDTETPRPHTEHHVNSIPARPAPTQQEPSSAPAPTAVTEEQHVQAAEARRNLATVLKRNAD
RGMFTINLSTGHERTLYAFLDPACINCRLLEPALKQLAREFSVVIYPVSVIGGESSTKRTAPLLCEPDSQ
KRATGWHQLYSADSGMAPTGDAPAAQDGQCLTAARAAIDVNNQAFRQFGFGGTPWVLSDTGWHLPSGILK
DATSVRLFLKATDSEEYHNEPAPR
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c38851-37727 Escherichia coli plasmid pCT, complete sequence
ATGACCATCCACTACACTGCAACACTGAATAATAAACACCTGTCCCTGACCGCCCTGTACCCTGACGGTA
ATCGGGAGGTGATTGCCATCCTGCCGGTAACAGAACTGGGCGCACTGATTAACCGTAATAACAGGCTGAT
GCACCTGTCCTTCAGTTCCCCTTTTCGCGAAATAACTGAAACGGTGCTTGTTGATACCGTTGATGCAGAA
CGTCCCGGACATCACATCGGCAGAATGCTCTCAGCGATTGATGCCTGCCTGGATGCCGAATATGCCGGAA
AAGGAAAACATCCCTCCCGGAAAAATGGCTTCTGGCGGACACTGATGTGTGGCTTTATCGCCGGAATTGC
TCTGCCGGCGACAGTTGCAGGTTACCACTGGATGAAGGCAGAGTCCCCTTCCACGCTGGCTTACCCTACA
TCTCAGGAATGGAGAGCTGAACCAGTAACCGACACAGAGACACCACGCCCACATACGGAACATCATGTTA
ACAGCATCCCGGCCCGCCCGGCTCCCACACAGCAGGAACCTTCTTCTGCCCCCGCCCCGACGGCAGTGAC
GGAAGAACAACACGTTCAGGCCGCTGAGGCCCGCCGTAATCTGGCCACAGTACTTAAACGCAACGCAGAC
CGGGGGATGTTCACCATTAACCTGTCCACTGGTCATGAACGCACGCTGTACGCCTTCCTTGACCCCGCAT
GCATCAACTGCCGTCTGCTGGAACCCGCGCTTAAGCAACTGGCCCGGGAATTCAGCGTGGTGATTTATCC
GGTCTCCGTGATTGGCGGGGAGTCCAGTACAAAGCGGACTGCTCCGCTGCTGTGTGAACCGGACTCACAA
AAACGGGCGACCGGATGGCATCAGCTGTATTCCGCTGACAGTGGCATGGCCCCCACCGGCGATGCACCGG
CCGCACAGGATGGACAGTGTCTGACCGCCGCACGTGCTGCCATCGATGTCAATAACCAGGCTTTCCGCCA
GTTCGGTTTTGGCGGAACCCCCTGGGTGTTATCAGATACCGGCTGGCACCTGCCGTCCGGCATCCTGAAA
GACGCCACTTCCGTTCGCCTCTTCCTGAAAGCAACAGATAGCGAGGAGTATCACAATGAGCCAGCACCAC
GTTAA