SecReT4
Protein ID: 305667849
T4SS name [ID]Tra_I [165]
Gene symboltraX
Locus tagpCT_069
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]52100..52669 [-]
Productconjugal transfer protein
Component typeTraX_I
UniProt IDQ68J99
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|305667849|ref|YP_003864323.1| conjugal transfer protein [Escherichia coli]
MKDDNSIDEKKPAPRLRRIGDIGINLFAPLAETRWMLRSCRHMLDQHKTRLKRLMPDRQPESPVCMTWEE
AVRASGLTVDELDRRLRRRRMFWRTGFWLMMIPVLLLCGMALAATALPVITLIRILVCLLLMSTIAALCA
SKALIASYRLWQLNERRVSEDEQGTFPDYLQARHGWKQATWLAITHRQY
 
Nucleotide Sequence: 570 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c52669-52100 Escherichia coli plasmid pCT, complete sequence
ATGAAAGACGACAACAGCATCGACGAAAAAAAACCGGCCCCCCGTCTCCGCCGCATCGGTGATATAGGGA
TAAATCTGTTCGCACCACTGGCCGAAACCCGCTGGATGCTGCGCAGCTGCCGCCATATGCTGGACCAGCA
TAAAACGCGCCTGAAGCGCCTCATGCCCGACCGGCAACCGGAGAGTCCGGTCTGTATGACCTGGGAGGAA
GCGGTCAGGGCCAGCGGACTGACGGTCGACGAACTGGACCGGCGTCTGCGACGTCGCAGGATGTTCTGGC
GGACAGGATTCTGGCTGATGATGATACCGGTACTTCTGCTGTGTGGTATGGCCCTTGCGGCCACCGCACT
GCCGGTCATCACCCTGATACGTATCCTGGTCTGCCTGTTACTGATGAGTACCATTGCAGCACTGTGTGCC
TCAAAAGCCCTGATTGCGTCATACCGCCTCTGGCAGCTGAATGAACGTCGGGTCAGCGAGGACGAACAGG
GCACATTCCCCGATTACCTGCAGGCCCGGCACGGCTGGAAACAGGCCACATGGCTGGCCATTACCCACCG
GCAGTACTGA