SecReT4
Protein ID: 305667850
T4SS name [ID]Tra_I [165]
Gene symboltraW
Locus tagpCT_070
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]52666..53706 [-]
Productconjugal transfer lipoprotein
Component typeTraW_I
UniProt IDQ68JA0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 346 a.a.     [Download]
>gi|305667850|ref|YP_003864324.1| conjugal transfer lipoprotein [Escherichia coli]
MQTATGTAITQNSEKLATVIAQDGQATRQQMIFSNETHRLEEARKSFSVPDSICSESASGIAAESRRAAA
SAAARLSQGGGVSSKPIRERLSRAADSPVREAYDSAGIHAGYCTEAEYARFGGTDVCPAVGDLPGGDSQV
RSLYQGAGTADTPAALTWDQKQIDAATAYMKNTARPSAGRAPGKGEVGTQTGRTYVGLQNEYNGIIDAAS
HPQLSLIADSTPNEATRGALTEALQSPSAAAYFDRTASSEARTRGHMSQREFEAFEAGRRYANTDWQQDL
QGMEGDNLLRELLRTTALLNWQMNDLKEQIRQGNVIAGQQLALAARQYYGQRLGELSQAMSQGSVR
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c53706-52666 Escherichia coli plasmid pCT, complete sequence
ATGCAGACGGCCACCGGCACAGCCATCACCCAGAACTCAGAAAAACTGGCCACCGTCATTGCCCAGGACG
GGCAGGCCACCCGTCAGCAGATGATATTCAGTAATGAAACACACCGCCTCGAGGAGGCCAGGAAAAGCTT
CAGCGTGCCGGACTCCATCTGCAGTGAATCCGCGTCCGGCATTGCAGCAGAAAGCCGCCGGGCAGCAGCG
TCTGCAGCGGCACGTCTGAGTCAGGGGGGAGGGGTCAGCAGTAAACCCATCCGGGAACGTCTCTCCCGGG
CTGCGGACTCCCCGGTCCGCGAGGCGTATGACAGTGCCGGCATCCACGCCGGTTACTGCACGGAAGCGGA
GTATGCCCGCTTTGGCGGAACTGATGTCTGCCCTGCCGTGGGCGATCTGCCGGGCGGAGACAGCCAGGTA
CGATCGCTCTATCAGGGCGCAGGCACAGCAGATACCCCGGCCGCTCTCACCTGGGATCAGAAACAGATTG
ATGCTGCGACGGCTTATATGAAAAACACCGCCAGACCGTCAGCGGGTCGTGCCCCGGGGAAAGGAGAAGT
GGGCACACAGACCGGGCGCACGTATGTGGGCCTGCAGAATGAATACAACGGCATCATCGATGCCGCCTCT
CATCCGCAGCTGTCACTGATTGCTGACAGTACCCCTAATGAAGCCACCCGTGGGGCACTGACTGAAGCCC
TGCAGTCACCGTCAGCTGCGGCATATTTTGACCGGACCGCATCATCAGAAGCCCGCACCCGTGGCCACAT
GAGCCAGCGGGAGTTTGAGGCCTTTGAAGCCGGCAGACGGTATGCCAACACCGACTGGCAGCAGGATCTG
CAGGGCATGGAAGGCGATAACCTTCTCCGTGAGCTGCTGCGCACCACCGCCCTGCTGAACTGGCAGATGA
ACGATCTGAAAGAGCAGATTCGTCAGGGTAACGTTATCGCCGGGCAGCAACTTGCGCTGGCCGCACGGCA
GTATTACGGACAGCGCCTTGGCGAACTGTCACAGGCCATGAGCCAGGGGAGCGTAAGATGA