SecReT4
Protein ID: 305667851
T4SS name [ID]Tra_I [165]
Gene symboltraV
Locus tagpCT_071
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]53829..54449 [-]
Productconjugal transfer protein
Component typeTraV_I
UniProt IDE0WH09
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|305667851|ref|YP_003864325.1| conjugal transfer protein [Escherichia coli]
MYSIHITPRCRRPARGQVFLKTLRVDGDSFSFTLPSACFTLRPSPNPRVIFASDRRADGEMSGIRLALPG
ETGTLITTATWQVNVPERPPFDIQHVIHWLLPAPLTALMSDNTWLWPDVPGTPALTAGDWPVMESDTPTL
KRVKRRTFTLIDNRNRQGWITRRFQCFPLAPLPESLSHRVPDILYPPKTEKKECKDNLQPHCLHSL
 
Nucleotide Sequence: 621 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c54449-53829 Escherichia coli plasmid pCT, complete sequence
ATGTACAGCATTCATATCACCCCCCGCTGCCGGCGTCCTGCCCGGGGACAGGTCTTCCTGAAAACACTGC
GCGTGGACGGTGACAGTTTCAGCTTCACCCTGCCGTCCGCCTGCTTCACACTGCGACCGTCCCCCAATCC
CCGGGTCATTTTTGCCAGTGACAGACGGGCTGACGGGGAGATGAGTGGTATTCGCCTGGCCCTGCCCGGA
GAGACAGGCACGCTGATAACAACGGCCACCTGGCAGGTTAACGTGCCGGAGCGACCGCCTTTTGATATAC
AGCATGTCATTCACTGGCTTCTGCCCGCACCACTCACTGCGCTGATGTCTGACAACACCTGGCTGTGGCC
GGATGTCCCCGGCACACCGGCACTCACAGCCGGAGACTGGCCGGTCATGGAAAGCGACACCCCGACACTG
AAACGCGTGAAGCGTCGTACCTTCACGCTCATCGATAACCGTAACCGTCAGGGATGGATCACGCGCCGCT
TCCAGTGTTTCCCGCTGGCTCCGCTGCCGGAATCACTCAGTCATCGCGTACCAGACATCCTGTATCCCCC
GAAAACGGAGAAAAAAGAATGCAAAGACAATCTGCAACCACACTGCTTGCACTCCTTGTAG