SecReT4
Protein ID: 305667859
T4SS name [ID]Tra_I [165]
Gene symboltraN
Locus tagpCT_079
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]61852..62826 [-]
Productconjugal transfer protein
Component typeTraN_I
UniProt IDE0WH17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3625 [PF12293], Evalue: 4e-89, Aligned region: 76..322
Protein Sequence: 324 a.a.     [Download]
>gi|305667859|ref|YP_003864333.1| conjugal transfer protein [Escherichia coli]
MHIHHLIGALLIVCGTVTAADNPGWKNARSPQTGGKTAQATGNTPAGGPPPAAQLPGNLPPPGAALVQEG
ASLDSPLNAGEIRELRGIMADNERAISAPLTSVVPRISSLTVNLSPGASLPLVRTALHNVSVVTFTDVNG
SPWPQSDPPYNAAPGHFDVQFNGNMVSVTPLRAWAAGNVTVYLKGLSVPVILNITSGETDTTTLSQEIDS
RLDLRIPRQGPASPVVSIPSEKIALHDATLQAFLDGVPPDDPAIRRLKFSGNVPDTTIWQHGDDLLVRSR
AMLRDEFEQTLASADGTRLWKLPVTPLLTFSVNGQSVHVTPELE
 
Nucleotide Sequence: 975 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c62826-61852 Escherichia coli plasmid pCT, complete sequence
ATGCACATACATCATCTTATTGGCGCACTGCTTATTGTGTGCGGCACTGTCACAGCTGCAGATAACCCGG
GCTGGAAAAATGCACGAAGCCCGCAGACCGGCGGAAAGACCGCACAGGCAACCGGGAACACCCCGGCAGG
CGGTCCCCCGCCAGCCGCACAACTCCCGGGAAACCTGCCGCCTCCCGGCGCTGCTCTTGTACAGGAAGGC
GCATCGCTGGATTCTCCCCTGAATGCCGGTGAAATTCGTGAACTCCGTGGGATAATGGCCGATAACGAAC
GGGCCATCAGTGCCCCGCTCACCAGTGTGGTGCCCCGTATCAGTTCCCTCACGGTGAATCTGTCTCCGGG
GGCCAGCCTGCCCCTTGTCCGTACCGCTCTGCATAACGTCAGCGTGGTGACCTTCACTGACGTCAACGGC
AGTCCGTGGCCACAGTCGGATCCGCCCTATAACGCTGCGCCCGGTCACTTTGACGTGCAGTTCAACGGCA
ATATGGTGTCCGTCACCCCCCTGCGCGCCTGGGCTGCCGGGAATGTGACGGTCTATCTCAAAGGATTGTC
TGTACCGGTCATCCTGAATATCACCAGTGGTGAAACAGACACCACTACCCTGAGTCAGGAAATCGACAGT
CGTCTGGATCTGCGTATTCCCCGGCAGGGACCTGCCAGCCCGGTGGTGTCCATACCGTCAGAAAAAATTG
CCCTGCATGACGCCACTCTGCAGGCCTTTCTGGACGGTGTGCCACCGGATGATCCCGCCATCCGCCGCCT
GAAATTCTCCGGTAACGTCCCGGACACCACCATCTGGCAACACGGCGATGATCTTCTCGTGCGCTCACGG
GCCATGCTGCGGGATGAATTTGAACAGACGCTGGCATCGGCTGATGGTACGCGGCTGTGGAAACTGCCGG
TGACCCCCTTACTCACCTTCTCCGTGAATGGTCAGTCCGTTCACGTCACCCCGGAACTGGAGTAA