SecReT4
Protein ID: 317054616
T4SS name [ID]Tra_I [164]
Gene symboltraH
Locus tagp3521_p027
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]26376..26834 [+]
ProductTraH
Component typeTraH_I
UniProt IDC1J8M8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 152 a.a.     [Download]
>gi|317054616|ref|YP_004119683.1| TraH [Escherichia coli]
MQKKRITLAGGVAMLCLSGCHLPPDNTAPARKYGAASEVAVTRHAQYQLWEQGTYSAALPSRQPGGSLQA
HSGRVSFDWEGDALELLSELARLRGQQFSYSGVRLPLPVSLHVRDMTFADALRLTEAQTAWRAVLSQSAG
RLHLSYMPTEKK
 
Nucleotide Sequence: 459 bp     [Download]
>gi|317054589|ref|NC_014843.1|:26376-26834 Escherichia coli plasmid p3521, complete sequence
ATGCAAAAAAAACGTATCACCCTTGCAGGGGGAGTTGCCATGCTCTGTCTGAGCGGCTGTCATCTTCCCC
CGGATAATACCGCACCGGCCAGGAAGTACGGTGCAGCTTCTGAAGTCGCTGTCACACGACATGCACAGTA
TCAGTTGTGGGAGCAGGGCACGTATTCTGCAGCCCTGCCTTCCCGCCAGCCCGGAGGCAGCCTGCAGGCT
CACAGCGGGCGGGTTTCCTTTGACTGGGAAGGCGATGCTCTGGAGCTCCTGAGCGAGCTGGCCCGTCTGC
GCGGACAACAGTTCAGTTACAGCGGCGTGCGTCTTCCCCTGCCCGTCTCACTCCATGTACGCGATATGAC
CTTCGCTGATGCCCTTCGTCTCACAGAGGCCCAGACTGCCTGGCGGGCAGTCCTCTCACAGTCAGCCGGG
CGTTTACATCTTTCCTATATGCCAACGGAGAAAAAATGA