SecReT4
Protein ID: 317054617
T4SS name [ID]Tra_I [164]
Gene symboltraI
Locus tagp3521_p028
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]26831..27667 [+]
ProductTraI
Component typeTraI_I
UniProt IDE7BT85
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 278 a.a.     [Download]
>gi|317054617|ref|YP_004119684.1| TraI [Escherichia coli]
MKIQVCLLLSGLLLAGCAGQHHRPPAGMAGNLPPPDLRAWLTPTDNQDDGISDTRRQMLTDAGRTLGFRG
GKAQRSWELIQALNARESTLNALYDFRPLISREGWLPPVIDEAQDVAHIQPDQIRTASRVWTILRPERFV
SNPPGWRDWLLRGLSTTATPGTEGRVVPEDRAQRRLWENALRQGWQEGRDNADLTLEANQKRLTRDYRGM
MLYALLWRQGMITRPDVTEQRQTVTGNGRKLITGNHVRRLKKHAEFTLQKSRWRPVVSTEGAPDEITR
 
Nucleotide Sequence: 837 bp     [Download]
>gi|317054589|ref|NC_014843.1|:26831-27667 Escherichia coli plasmid p3521, complete sequence
ATGAAAATACAGGTCTGTCTCCTGCTGTCCGGGCTCCTGCTGGCAGGCTGTGCCGGACAGCACCATCGCC
CCCCTGCCGGTATGGCAGGCAATTTACCACCGCCGGATCTCCGGGCATGGCTGACGCCCACTGACAACCA
GGATGACGGCATTTCAGACACCCGTCGCCAGATGCTCACGGACGCCGGACGAACGCTGGGATTCCGTGGC
GGAAAAGCACAGCGCTCATGGGAACTGATTCAGGCACTGAATGCCCGGGAAAGTACACTGAATGCCCTGT
ATGACTTCCGTCCCCTTATCAGCAGGGAAGGCTGGCTACCCCCTGTTATTGATGAAGCGCAGGATGTTGC
TCACATTCAGCCTGACCAGATAAGAACCGCGTCCCGTGTCTGGACCATCCTGCGCCCCGAACGTTTTGTC
AGTAACCCGCCGGGCTGGCGTGACTGGCTTCTGCGGGGGCTTTCCACTACCGCCACCCCGGGAACTGAGG
GCCGTGTTGTACCGGAAGACCGCGCACAGCGCAGACTCTGGGAAAACGCACTCCGCCAGGGCTGGCAGGA
AGGCCGTGACAACGCTGACCTCACCCTGGAAGCCAACCAGAAACGCCTGACCCGGGATTACCGGGGAATG
ATGCTTTATGCCCTGCTCTGGCGTCAGGGCATGATCACACGCCCGGATGTGACTGAACAGCGGCAGACCG
TCACCGGTAACGGCAGGAAACTCATCACCGGAAATCACGTCCGCCGTCTGAAAAAACACGCGGAATTCAC
CCTGCAAAAATCACGCTGGCGTCCGGTCGTCAGCACGGAAGGAGCCCCCGATGAAATTACCCGATGA