SecReT4
Protein ID: 317054618
T4SS name [ID]Tra_I [164]
Gene symboltraJ
Locus tagp3521_p029
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]27651..28799 [+]
ProductTraJ
Component typeTraJ_I
UniProt IDQ68JB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.3e-33, Aligned region: 144..298
Protein Sequence: 382 a.a.     [Download]
>gi|317054618|ref|YP_004119685.1| TraJ [Escherichia coli]
MKLPDEFGTFPFARFTAEEFRYFFAWCARHRVSDIDLTGGSPVSVSRFGRRVRSSAHPLPSSIMMALSDE
LFGREVLPRVLSGHPVDRTIQVSGDASGRYGLQRGQRVRLRCHLIQGTSATEEKVISVTMRVIPSDIPDI
LTMNIEPDLLDAMLRKTGLGFICGETGSGKSTLAAALYRYIQTHFPDRKTVTYEDPVEYILGGENDLLPP
HQAEIGRDVESFAAGLRSAVRRNPDIIGIGEIRDYETADAAVQAGNTGHFCIGTMHTKSPGETFARLLGL
FPPEIRDSMAAAILSLVQFILVQVLVRTNDGGRQAVREYIVITDELRDTLSRQSHATWGHYIDEIIRKEK
RRIRDQVLTMYQTGSIEASEAALFIPAGEFPK
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|317054589|ref|NC_014843.1|:27651-28799 Escherichia coli plasmid p3521, complete sequence
ATGAAATTACCCGATGAGTTCGGCACATTCCCTTTCGCCCGTTTCACGGCCGAAGAGTTTCGCTATTTTT
TTGCCTGGTGTGCCCGACACCGCGTCAGTGATATCGATCTGACAGGCGGCTCACCGGTATCTGTCAGTCG
CTTTGGACGGCGGGTACGTTCGTCCGCACATCCTCTGCCGTCCTCCATCATGATGGCGCTGAGTGATGAA
TTGTTTGGACGGGAAGTCCTTCCCCGGGTACTGTCCGGTCATCCCGTGGACCGTACCATTCAGGTCAGCG
GTGATGCCTCCGGTCGCTACGGTCTGCAACGGGGGCAGCGTGTTCGCCTGCGCTGTCACCTGATTCAGGG
AACATCAGCAACAGAAGAAAAAGTAATCTCCGTCACCATGCGGGTGATCCCGTCCGATATTCCGGACATC
CTCACCATGAATATTGAACCGGACCTGCTGGATGCCATGCTCCGGAAAACCGGTCTGGGTTTCATCTGCG
GAGAGACCGGCTCCGGTAAATCCACACTGGCAGCGGCACTGTACCGCTACATTCAGACGCATTTCCCCGA
CCGCAAAACGGTGACCTATGAAGATCCGGTGGAATACATTCTGGGGGGAGAGAATGACCTTCTGCCACCC
CATCAGGCCGAAATCGGGCGTGATGTGGAAAGTTTTGCGGCAGGACTTCGCTCTGCCGTTCGCCGTAACC
CGGACATCATCGGTATCGGTGAAATCAGGGATTATGAAACGGCAGATGCAGCCGTCCAGGCAGGTAACAC
CGGTCACTTCTGCATCGGCACCATGCACACCAAATCACCCGGTGAAACCTTTGCCCGGCTGCTGGGGTTA
TTTCCACCGGAAATCAGGGATTCAATGGCAGCCGCCATCCTTTCCCTGGTGCAGTTCATTCTGGTGCAGG
TCCTGGTCAGAACAAATGACGGTGGCAGACAGGCCGTCCGGGAATACATCGTCATAACTGACGAACTGCG
TGATACGCTCTCCCGGCAGTCCCATGCGACATGGGGGCATTACATTGATGAAATCATTCGCAAGGAAAAA
CGGCGGATACGGGATCAGGTTCTGACCATGTATCAGACGGGCAGCATTGAGGCATCAGAAGCTGCGCTCT
TCATCCCGGCCGGAGAATTCCCCAAATGA