SecReT4
Protein ID: 317054619
T4SS name [ID]Tra_I [164]
Gene symboltraK
Locus tagp3521_p030
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]28796..29086 [+]
ProductTraK
Component typeTraK_I
UniProt IDB7LIR9, Q68JB3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 96 a.a.     [Download]
>gi|317054619|ref|YP_004119686.1| TraK [Escherichia coli]
MKREGFWRDVTPPLNIYGVPLPFTMIYLLLFPYPSKTTFWVCSGILLFFVLLGYSGWTVRTLCRRLYSLV
QGKQASGRPWWYRHRTELPREWRGTE
 
Nucleotide Sequence: 291 bp     [Download]
>gi|317054589|ref|NC_014843.1|:28796-29086 Escherichia coli plasmid p3521, complete sequence
ATGAAACGCGAAGGCTTCTGGCGGGATGTCACCCCGCCACTGAATATTTATGGTGTCCCGTTGCCGTTTA
CCATGATTTACCTGCTGCTGTTTCCGTATCCGTCAAAAACAACATTCTGGGTGTGCAGCGGCATTCTGCT
GTTTTTTGTGCTCCTGGGGTACTCAGGATGGACTGTCCGGACGCTCTGCCGGCGTCTGTACAGCCTGGTG
CAGGGTAAACAGGCGTCAGGCCGTCCCTGGTGGTACCGGCATCGCACAGAATTACCCCGTGAATGGCGCG
GAACGGAATAA