SecReT4
Protein ID: 317054624
T4SS name [ID]Tra_I [164]
Gene symboltraN
Locus tagp3521_p035
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]34296..35255 [+]
ProductTraN
Component typeTraN_I
UniProt IDQ68JA9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3625 [PF12293], Evalue: 3.7e-89, Aligned region: 71..317
Protein Sequence: 319 a.a.     [Download]
>gi|317054624|ref|YP_004119691.1| TraN [Escherichia coli]
MHIHHLIGALLIVCGTVTAADNPGWKNARSPQTGGKTAQATGNTPPAAQLPGNLPPPSAALVQEGASLDS
PLNAGEIRELRGIMADNERAISAPLTSVVPRISSLTVNLSPGASLPLVRTALHNVSVVTFTDVNGSPWPQ
SDPPYNAAPGHFDVQFNGNMVSVTPLRAWAAGNVTVYLKGLSVPVILNITSGETDTTTLSQEIDSRLDLR
IPRQGPASPVVSIPSEKIALHDATLQAFLDGVPPDDPAIRRLKFSGNVPDTTIWQHGDDLLVRSRAMLRD
EFEQTLASADGTRLWKLPVTPLLTFSVNGQSVHVTPELE
 
Nucleotide Sequence: 960 bp     [Download]
>gi|317054589|ref|NC_014843.1|:34296-35255 Escherichia coli plasmid p3521, complete sequence
ATGCACATACATCATCTTATTGGCGCACTGCTTATTGTGTGCGGCACTGTCACAGCTGCAGATAACCCGG
GCTGGAAAAATGCACGAAGCCCACAGACCGGCGGAAAGACCGCACAGGCAACCGGGAACACCCCGCCAGC
CGCACAACTCCCGGGAAACCTGCCGCCTCCCAGCGCTGCTCTTGTACAGGAAGGCGCATCGCTGGATTCT
CCCCTGAATGCCGGTGAAATTCGTGAACTCCGTGGGATAATGGCCGATAACGAACGGGCCATCAGTGCCC
CGCTCACCAGTGTGGTGCCCCGTATCAGTTCCCTCACGGTAAATCTGTCTCCGGGGGCCAGCCTGCCCCT
TGTCCGTACCGCTCTGCATAACGTCAGCGTGGTGACCTTCACGGACGTCAACGGCAGTCCGTGGCCACAG
TCGGATCCGCCCTATAACGCTGCGCCCGGTCACTTTGACGTGCAGTTCAACGGCAATATGGTGTCCGTCA
CCCCCCTACGCGCCTGGGCTGCCGGGAATGTGACGGTCTATCTCAAAGGATTGTCTGTACCGGTCATCCT
GAATATCACCAGTGGTGAAACGGATACCACTACCCTGAGTCAGGAAATCGACAGTCGTCTGGATCTGCGC
ATTCCCCGGCAGGGACCTGCCAGCCCGGTGGTGTCCATACCGTCAGAAAAAATTGCCCTGCATGACGCCA
CTCTGCAGGCCTTTCTGGACGGTGTGCCACCGGATGATCCCGCCATCCGCCGCCTGAAATTCTCCGGTAA
CGTCCCGGACACCACCATCTGGCAACACGGCGATGATCTTCTCGTGCGCTCACGGGCCATGCTGCGGGAT
GAATTTGAACAGACGCTGGCATCGGCTGATGGTACGCGGCTGTGGAAACTGCCGGTGACCCCCTTACTCA
CCTTCTCCGTGAATGGTCAGTCCGTTCACGTCACCCCGGAACTGGAGTAA