SecReT4
Protein ID: 317054626
T4SS name [ID]Tra_I [164]
Gene symboltraP
Locus tagp3521_p037
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]36587..37300 [+]
ProductTraP
Component typeTraP_I
UniProt IDQ68JA7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|317054626|ref|YP_004119693.1| TraP [Escherichia coli]
MKNEHEDPGSFGETPAPASGKSFLKRQYMGYSLPVWAGCALIILAAIWYKFLRTPSEPPADAGFAVTPPA
AESWAEPMTMTETGGGNNMPAPPVAPQADMQQLARDLKAELDRRDEEIRRTLTMLKDSITTLSNAIQKDE
AWAQETRQLLEETRKQVHTLQMQGALPAPTGNNRQPAKTLPSPLQGMKIMSVEKGMAWIRWQGSAWAVRE
GDSLGNITITRIDPSSRAVITSAGTLR
 
Nucleotide Sequence: 714 bp     [Download]
>gi|317054589|ref|NC_014843.1|:36587-37300 Escherichia coli plasmid p3521, complete sequence
ATGAAAAACGAACATGAAGATCCCGGCAGCTTTGGCGAAACGCCGGCACCGGCATCCGGCAAATCCTTCC
TGAAACGCCAGTATATGGGATACAGCCTGCCGGTCTGGGCCGGCTGTGCCCTCATCATCCTGGCCGCCAT
CTGGTACAAGTTTCTGCGGACACCCTCAGAGCCCCCTGCAGATGCAGGCTTTGCTGTCACACCGCCCGCT
GCTGAGAGCTGGGCAGAGCCCATGACCATGACGGAGACCGGGGGCGGAAACAACATGCCCGCACCGCCGG
TTGCCCCACAGGCAGATATGCAGCAACTTGCCCGTGATCTGAAAGCAGAGCTGGACAGACGGGATGAGGA
AATCCGACGCACCCTGACCATGCTGAAGGACAGTATCACCACTCTCAGTAACGCCATTCAGAAGGATGAG
GCCTGGGCACAGGAAACCCGTCAGTTGCTTGAGGAGACCCGTAAGCAGGTGCATACCCTGCAGATGCAGG
GAGCACTGCCAGCCCCGACCGGGAATAACAGACAGCCTGCGAAAACCCTGCCTTCACCTCTGCAGGGCAT
GAAAATCATGTCGGTGGAGAAAGGCATGGCCTGGATCCGCTGGCAGGGCAGTGCCTGGGCAGTACGGGAA
GGCGACAGTCTGGGAAACATCACCATCACCCGGATTGACCCGTCCAGCCGGGCAGTCATCACCTCTGCCG
GTACATTACGATGA