SecReT4
Protein ID: 317054628
T4SS name [ID]Tra_I [164]
Gene symboltraR
Locus tagp3521_p039
StrainEscherichia coli plasmid p3521 (NC_014843)
Repliconplasmid p3521 [GenBank: NC_014843] [Browse all T4SS(s) in this replicon]
Location [Strand]37874..38272 [+]
ProductTraR
Component typeTraR_I
UniProt IDQ68JA5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 132 a.a.     [Download]
>gi|317054628|ref|YP_004119695.1| TraR [Escherichia coli]
MSRLRAMAARLRAASVYVQLCLMACRDRLVRLLLLLPVMLLPHTAMANTLFDMIKTVGDGARGSSSSFVA
IGQVIGLVLFIGGLLGLKQIGKKPGAGLACLLSILVGVCLAVVPELMGSGQKTLGLSPVSIS
 
Nucleotide Sequence: 399 bp     [Download]
>gi|317054589|ref|NC_014843.1|:37874-38272 Escherichia coli plasmid p3521, complete sequence
ATGTCACGACTTCGTGCCATGGCGGCGCGTCTGCGCGCTGCATCTGTTTATGTTCAGTTATGCCTGATGG
CCTGCCGTGACCGGCTGGTACGCCTGTTACTGCTGCTTCCCGTGATGCTGCTGCCCCACACCGCAATGGC
AAATACCCTCTTCGATATGATTAAAACCGTTGGCGATGGTGCCAGAGGCTCCAGCAGTTCGTTTGTGGCT
ATCGGTCAGGTTATTGGCCTGGTGCTCTTTATCGGCGGCCTGCTTGGCCTCAAACAAATCGGTAAAAAAC
CCGGTGCAGGGCTGGCCTGCCTGCTGTCAATTCTGGTCGGCGTCTGCCTTGCCGTCGTACCGGAACTGAT
GGGCAGCGGACAGAAAACGCTCGGTCTTTCTCCGGTTTCAATCAGTTAA